(data stored in ACNUC7421 zone)

EMBL: CP000947.PE123

CP000947.PE123       Location/Qualifiers
FT   CDS             135308..136033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0125"
FT                   /product="extracellular solute-binding protein family 3"
FT                   /note="PFAM: extracellular solute-binding protein family 3;
FT                   KEGG: hso:HS_0252 arginine ABC transporter,
FT                   substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ACA30978"
FT                   /db_xref="GOA:B0UVI6"
FT                   /db_xref="InterPro:IPR001320"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:B0UVI6"
FT                   /protein_id="ACA30978.1"
FT                   /translation="MKKLLLATMLAGATIGANAQDITFAMEPSYPPFELTNEKGEIIGF
FT                   DVDIANAICKEIQANCSFKAQAFDALIPSLIKGRGGFDAAISAIDITEARAKQVAFTDS
FT                   YYESSASFIALKGKADLTTAKVVGVQNGTTYQQYANKEAKQYQSKSYASLQDAILDLKN
FT                   GRIDLIFGDTDVLRDMFDKNPELQFVGERVTDKRYFNNGLGIAVNKKNTALVEQLNKGI
FT                   SAIKANGEYQKIYDKWMTK"
     MKKLLLATML AGATIGANAQ DITFAMEPSY PPFELTNEKG EIIGFDVDIA NAICKEIQAN        60
     CSFKAQAFDA LIPSLIKGRG GFDAAISAID ITEARAKQVA FTDSYYESSA SFIALKGKAD       120
     LTTAKVVGVQ NGTTYQQYAN KEAKQYQSKS YASLQDAILD LKNGRIDLIF GDTDVLRDMF       180
     DKNPELQFVG ERVTDKRYFN NGLGIAVNKK NTALVEQLNK GISAIKANGE YQKIYDKWMT       240
     K                                                                       241
//

If you have problems or comments...

PBIL Back to PBIL home page