(data stored in ACNUC7421 zone)

EMBL: CP000947.PE124

CP000947.PE124       Location/Qualifiers
FT   CDS             136038..136709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0126"
FT                   /product="polar amino acid ABC transporter, inner membrane
FT                   subunit"
FT                   /note="TIGRFAM: polar amino acid ABC transporter, inner
FT                   membrane subunit; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; KEGG: hso:HS_0253
FT                   arginine ABC transporter, permease"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ACA30989"
FT                   /db_xref="GOA:B0UVI7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B0UVI7"
FT                   /protein_id="ACA30989.1"
FT                   /translation="MFIDYLPLMYTATLMTLGLAVCSLLLGLALSIFFVVLETHKWACI
FT                   RKPTATIVTLLRGLPEILVVFLIYFGVPEILEWVIGEYVEFGAFGCGVVALSIIFASYA
FT                   SQSLRGAIQAIPLGQWESGAALGLSRSYTFIFLIMPQVWRHALPGLSNQWLVLLKDTAL
FT                   VSLIGVHDLMRQAELINTNTHQPFTWYGFAALLYLLITLFSQFIIRKLERRVTRFERAT
FT                   N"
     MFIDYLPLMY TATLMTLGLA VCSLLLGLAL SIFFVVLETH KWACIRKPTA TIVTLLRGLP        60
     EILVVFLIYF GVPEILEWVI GEYVEFGAFG CGVVALSIIF ASYASQSLRG AIQAIPLGQW       120
     ESGAALGLSR SYTFIFLIMP QVWRHALPGL SNQWLVLLKD TALVSLIGVH DLMRQAELIN       180
     TNTHQPFTWY GFAALLYLLI TLFSQFIIRK LERRVTRFER ATN                         223
//

If you have problems or comments...

PBIL Back to PBIL home page