(data stored in ACNUC7421 zone)

EMBL: CP000947.PE125

CP000947.PE125       Location/Qualifiers
FT   CDS             136720..137403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0127"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: hso:HS_0254 arginine ABC
FT                   transporter, permease"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ACA30998"
FT                   /db_xref="GOA:B0UVI8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B0UVI8"
FT                   /protein_id="ACA30998.1"
FT                   /translation="MIKDYFLTIAQGIPTSLILTIVALLVAFFLALTLTFALSMEKKWL
FT                   SLPINLFLTIFTGTPLLVQFFLIYAGPGQFSWIVNSFLWPLLSSAWFCAILTLALNSTA
FT                   YSTQLFYGAVKAISKGQWESCVALGLSRWQTLKILVPYALKRALPSYSNEIILVFKGTS
FT                   LASIITILDIMGYARQLYGTEYDALTIYGIAGVIYLIITGIATLLLRRLERKVLVFERL
FT                   ETERV"
     MIKDYFLTIA QGIPTSLILT IVALLVAFFL ALTLTFALSM EKKWLSLPIN LFLTIFTGTP        60
     LLVQFFLIYA GPGQFSWIVN SFLWPLLSSA WFCAILTLAL NSTAYSTQLF YGAVKAISKG       120
     QWESCVALGL SRWQTLKILV PYALKRALPS YSNEIILVFK GTSLASIITI LDIMGYARQL       180
     YGTEYDALTI YGIAGVIYLI ITGIATLLLR RLERKVLVFE RLETERV                     227
//

If you have problems or comments...

PBIL Back to PBIL home page