(data stored in ACNUC7421 zone)

EMBL: CP000947.PE126

CP000947.PE126       Location/Qualifiers
FT   CDS             complement(137509..137796)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0128"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hso:HS_0255 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31009"
FT                   /db_xref="InterPro:IPR020493"
FT                   /db_xref="UniProtKB/TrEMBL:B0UVI9"
FT                   /protein_id="ACA31009.1"
FT                   /translation="MNIMLKPRSVMIILASVFATITTTHVQANTLPEQCQKLFKETENL
FT                   IAEAEKQPGTHVQLAKIKSKLKQSKQQILAMEHDIQIKSCDIGLAKLHTK"
     MNIMLKPRSV MIILASVFAT ITTTHVQANT LPEQCQKLFK ETENLIAEAE KQPGTHVQLA        60
     KIKSKLKQSK QQILAMEHDI QIKSCDIGLA KLHTK                                   95
//

If you have problems or comments...

PBIL Back to PBIL home page