(data stored in ACNUC7421 zone)

EMBL: CP000947.PE127

CP000947.PE127       Location/Qualifiers
FT   CDS             138256..139821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0129"
FT                   /product="cytochrome bd ubiquinol oxidase subunit I"
FT                   /note="PFAM: cytochrome bd ubiquinol oxidase subunit I;
FT                   KEGG: hso:HS_0256 cytochrome d ubiquinol oxidase, subunit
FT                   I"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31020"
FT                   /db_xref="GOA:B0UVJ0"
FT                   /db_xref="InterPro:IPR002585"
FT                   /db_xref="UniProtKB/TrEMBL:B0UVJ0"
FT                   /protein_id="ACA31020.1"
FT                   /translation="MLDVVELSRLQFALTALYHFLFVPLTLGLSFILVIMETLYVATGK
FT                   EVYKDMTKFWGKLFGINFALGVTTGITMEFQFGTNWSYYSHYVGDIFGAPLAIEALLAF
FT                   FLESTFVGLFFFGWDRLSKAKHLLTTYCVAFGSNFSAMWILVANGWMQNPVASEFNFET
FT                   MRMEMTSFMDLWLNPVAQSKFLHTLSAGYVTSACFVLAISSYYLLKRRDVGFAKRSFSI
FT                   ASVFGIIATVSVLIMGDESGYEIGQTQPVKLAAMEGEWHTQPAPASWNMIVVPNQAEQK
FT                   NDFALQIPYAAGIIVTRSLDKQFTGLVDLQALNEQRVRNGMVAYGLLQQLKAEKKANGQ
FT                   VNEETKAQFNAVKDDLGFGLLLKRYTDAVVDATDEQVKQAAADTIPNVGPTFWSFRIMM
FT                   LAGGLILVLMIAAFVQNMRKTVGRSPLLLKALLWGLPLPWIAMESGWFLAEYGRQPWAI
FT                   YDVLPVGVAASNLTTADLWLSIGLICALYTIFLVVEMYLMFKYGRLGPSSLKTGRYYFE
FT                   QLSK"
     MLDVVELSRL QFALTALYHF LFVPLTLGLS FILVIMETLY VATGKEVYKD MTKFWGKLFG        60
     INFALGVTTG ITMEFQFGTN WSYYSHYVGD IFGAPLAIEA LLAFFLESTF VGLFFFGWDR       120
     LSKAKHLLTT YCVAFGSNFS AMWILVANGW MQNPVASEFN FETMRMEMTS FMDLWLNPVA       180
     QSKFLHTLSA GYVTSACFVL AISSYYLLKR RDVGFAKRSF SIASVFGIIA TVSVLIMGDE       240
     SGYEIGQTQP VKLAAMEGEW HTQPAPASWN MIVVPNQAEQ KNDFALQIPY AAGIIVTRSL       300
     DKQFTGLVDL QALNEQRVRN GMVAYGLLQQ LKAEKKANGQ VNEETKAQFN AVKDDLGFGL       360
     LLKRYTDAVV DATDEQVKQA AADTIPNVGP TFWSFRIMML AGGLILVLMI AAFVQNMRKT       420
     VGRSPLLLKA LLWGLPLPWI AMESGWFLAE YGRQPWAIYD VLPVGVAASN LTTADLWLSI       480
     GLICALYTIF LVVEMYLMFK YGRLGPSSLK TGRYYFEQLS K                           521
//

If you have problems or comments...

PBIL Back to PBIL home page