(data stored in ACNUC7421 zone)

EMBL: CP000947.PE128

CP000947.PE128       Location/Qualifiers
FT   CDS             139836..140972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0130"
FT                   /product="cytochrome d ubiquinol oxidase, subunit II"
FT                   /EC_number="3.1.3.1"
FT                   /note="TIGRFAM: cytochrome d ubiquinol oxidase, subunit II;
FT                   PFAM: cytochrome bd ubiquinol oxidase subunit II; KEGG:
FT                   hso:HS_0257 cytochrome d ubiquinol oxidase, subunit II"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31032"
FT                   /db_xref="GOA:B0UVJ1"
FT                   /db_xref="InterPro:IPR003317"
FT                   /db_xref="UniProtKB/TrEMBL:B0UVJ1"
FT                   /protein_id="ACA31032.1"
FT                   /translation="MIDYEFLRFIWWILVGVLLIGFAVTDGFDMGVLSLLPFAGKKEVE
FT                   KRIMINSIAPHWDGNQVWLLTAGGAMFAAWPIVYAASFSGFYVAMILVLAALFFRPVGL
FT                   EYRAKIDNPTWRKFWDWGLFAGGFVPSLVFGVAFGNLLQGVPFEFNDLMQVTYTGSFFE
FT                   LLNPFAILCGLISFSMLTTQGAAWLQMKTTSELRERARVITQVGAFVTLLTFILAGVWL
FT                   YFKEGFIVTSVLDHNAPSDPTVKTVAVEVGAWFKNYFDAPVLFILPALAVGGALLNILA
FT                   SKANRSGFAFFFSSITMAGIILTCGVAMFPFVMPSISHPNMSLLMWDSTSSELTLTLML
FT                   GFALFFVVILLSYTIWAYAKMFGRLDADFIEENKNSLY"
     MIDYEFLRFI WWILVGVLLI GFAVTDGFDM GVLSLLPFAG KKEVEKRIMI NSIAPHWDGN        60
     QVWLLTAGGA MFAAWPIVYA ASFSGFYVAM ILVLAALFFR PVGLEYRAKI DNPTWRKFWD       120
     WGLFAGGFVP SLVFGVAFGN LLQGVPFEFN DLMQVTYTGS FFELLNPFAI LCGLISFSML       180
     TTQGAAWLQM KTTSELRERA RVITQVGAFV TLLTFILAGV WLYFKEGFIV TSVLDHNAPS       240
     DPTVKTVAVE VGAWFKNYFD APVLFILPAL AVGGALLNIL ASKANRSGFA FFFSSITMAG       300
     IILTCGVAMF PFVMPSISHP NMSLLMWDST SSELTLTLML GFALFFVVIL LSYTIWAYAK       360
     MFGRLDADFI EENKNSLY                                                     378
//

If you have problems or comments...

PBIL Back to PBIL home page