(data stored in ACNUC7421 zone)

EMBL: CP000947.PE129

CP000947.PE129       Location/Qualifiers
FT   CDS             141347..141772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0131"
FT                   /product="Pol-Pal system-associated acyl-CoA thioesterase"
FT                   /note="TIGRFAM: Pol-Pal system-associated acyl-CoA
FT                   thioesterase; PFAM: thioesterase superfamily protein; KEGG:
FT                   hso:HS_0258 possible thioesterase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31043"
FT                   /db_xref="GOA:B0UVJ2"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR006684"
FT                   /db_xref="InterPro:IPR008272"
FT                   /db_xref="InterPro:IPR014166"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:B0UVJ2"
FT                   /protein_id="ACA31043.1"
FT                   /translation="MPVFKLPVRVYYEDTDAGGVVYHARYLHFFERARTEYLRTLNFSQ
FT                   QNLLNERKVAFVVKSMQIDYCVPAKLDDLLIVETYVVAIKGASIVFSQILKRDDEIISQ
FT                   AVVKVASVDLVKMRPVAIPQEIKAEIKLNDNIFGVMS"
     MPVFKLPVRV YYEDTDAGGV VYHARYLHFF ERARTEYLRT LNFSQQNLLN ERKVAFVVKS        60
     MQIDYCVPAK LDDLLIVETY VVAIKGASIV FSQILKRDDE IISQAVVKVA SVDLVKMRPV       120
     AIPQEIKAEI KLNDNIFGVM S                                                 141
//

If you have problems or comments...

PBIL Back to PBIL home page