(data stored in ACNUC7421 zone)

EMBL: CP000947.PE13

CP000947.PE13        Location/Qualifiers
FT   CDS             9638..11314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0013"
FT                   /product="acetolactate synthase, large subunit,
FT                   biosynthetic type"
FT                   /note="TIGRFAM: acetolactate synthase, large subunit,
FT                   biosynthetic type; PFAM: thiamine pyrophosphate protein
FT                   domain protein TPP-binding; thiamine pyrophosphate protein
FT                   central region; thiamine pyrophosphate protein TPP binding
FT                   domain protein; KEGG: hso:HS_0147 acetohydroxy acid
FT                   synthase II, large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31031"
FT                   /db_xref="GOA:B0UUX1"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012846"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR039368"
FT                   /db_xref="UniProtKB/TrEMBL:B0UUX1"
FT                   /protein_id="ACA31031.1"
FT                   /translation="MNGANLVVECLKAHGVTSLFGYPGGAIMPVYDAIYDSGLDHLLCR
FT                   NEQGAAMAAIGYARSTNKVGVCVATSGPGATNLITGLGDALMDSIPIIAITGQVASNFI
FT                   GTDAFQEADILGLSLACTKHSFIVQHIDELPEIIAKAFQIAQSGRPGPVLIDLPKDVQF
FT                   APTSLKPIVYPKIADSLQNLVALEQAKNLLSQAKRPVLYVGGGVGMAKSSDGMSGVKAI
FT                   RTFLDITNIPSVSTLKGLGTIPPKHPLYMGMIGMHGTKAANYAVQECDLLIACGARFDD
FT                   RVTGKLDTFAPHAKVIHIDIDVAEINKLRKADVGLQGDLVEAVTNLAQLLDIEPWRKDI
FT                   EQLKASFDFNYIENTEDKEIEPCALLHTLSERKAKNAVITTDVGQHQMWSAQHMKHYEP
FT                   ENYITSAGFGSMGFGLPAAIGAAKARPQDPVILITGDGSLMMNIQELGSIKRGNLPIKI
FT                   LLLDNQRLGMVRQWQSLFFHGRHSHTVLDDNPDFVTLASAFGIAGERIEKASEVSDALD
FT                   RLLNAKEAYLLHVCIPDEENVWPLVPPNTCNSNMIEEDIGV"
     MNGANLVVEC LKAHGVTSLF GYPGGAIMPV YDAIYDSGLD HLLCRNEQGA AMAAIGYARS        60
     TNKVGVCVAT SGPGATNLIT GLGDALMDSI PIIAITGQVA SNFIGTDAFQ EADILGLSLA       120
     CTKHSFIVQH IDELPEIIAK AFQIAQSGRP GPVLIDLPKD VQFAPTSLKP IVYPKIADSL       180
     QNLVALEQAK NLLSQAKRPV LYVGGGVGMA KSSDGMSGVK AIRTFLDITN IPSVSTLKGL       240
     GTIPPKHPLY MGMIGMHGTK AANYAVQECD LLIACGARFD DRVTGKLDTF APHAKVIHID       300
     IDVAEINKLR KADVGLQGDL VEAVTNLAQL LDIEPWRKDI EQLKASFDFN YIENTEDKEI       360
     EPCALLHTLS ERKAKNAVIT TDVGQHQMWS AQHMKHYEPE NYITSAGFGS MGFGLPAAIG       420
     AAKARPQDPV ILITGDGSLM MNIQELGSIK RGNLPIKILL LDNQRLGMVR QWQSLFFHGR       480
     HSHTVLDDNP DFVTLASAFG IAGERIEKAS EVSDALDRLL NAKEAYLLHV CIPDEENVWP       540
     LVPPNTCNSN MIEEDIGV                                                     558
//

If you have problems or comments...

PBIL Back to PBIL home page