(data stored in ACNUC7421 zone)

EMBL: CP000947.PE130

CP000947.PE130       Location/Qualifiers
FT   CDS             141769..142452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0132"
FT                   /product="Tol-Pal system TolQ"
FT                   /note="TIGRFAM: Tol-Pal system TolQ; PFAM: MotA/TolQ/ExbB
FT                   proton channel; KEGG: hso:HS_0259 biopolymer transport
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31054"
FT                   /db_xref="GOA:B0UVJ3"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="InterPro:IPR014163"
FT                   /db_xref="UniProtKB/TrEMBL:B0UVJ3"
FT                   /protein_id="ACA31054.1"
FT                   /translation="MTAELDFLELFLKASIVVQIVIVILISFSIISWAIIIQRSRILTR
FT                   ALKDSTLFEERFWSGEDLYKLYDGLSNRRNGLNSSERIFYVGFKEFNRLKQANPDAPEA
FT                   IIQGSSRAMNLTMNREVEDLETRVPFLATVASISPYIGLFGTVWGIMHAFMALSGAKQA
FT                   TLQMVAPGIAEALIATAIGLFAAIPAVMAYNRLSLRVNKLEQNYANFIDEFTTILHRQA
FT                   FGKNH"
     MTAELDFLEL FLKASIVVQI VIVILISFSI ISWAIIIQRS RILTRALKDS TLFEERFWSG        60
     EDLYKLYDGL SNRRNGLNSS ERIFYVGFKE FNRLKQANPD APEAIIQGSS RAMNLTMNRE       120
     VEDLETRVPF LATVASISPY IGLFGTVWGI MHAFMALSGA KQATLQMVAP GIAEALIATA       180
     IGLFAAIPAV MAYNRLSLRV NKLEQNYANF IDEFTTILHR QAFGKNH                     227
//

If you have problems or comments...

PBIL Back to PBIL home page