(data stored in ACNUC7421 zone)

EMBL: CP000947.PE131

CP000947.PE131       Location/Qualifiers
FT   CDS             142520..142942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0133"
FT                   /product="Biopolymer transport protein ExbD/TolR"
FT                   /note="PFAM: Biopolymer transport protein ExbD/TolR; KEGG:
FT                   hso:HS_0260 biopolymer transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31065"
FT                   /db_xref="GOA:B0UVJ4"
FT                   /db_xref="InterPro:IPR003400"
FT                   /db_xref="InterPro:IPR014168"
FT                   /db_xref="UniProtKB/TrEMBL:B0UVJ4"
FT                   /protein_id="ACA31065.1"
FT                   /translation="MSYRRKRRDIKSEINIIPFLDVLLVLLLIFMATAPIISQSVQVEL
FT                   PEAVESQNVSKEDKTPVILEVSGIGQYALSIGGERTEGITEELVTQLSKQEFDKDNNTL
FT                   FLVGGAKDVPYEEVIKALNLLHVAGIKSVGLMTNPL"
     MSYRRKRRDI KSEINIIPFL DVLLVLLLIF MATAPIISQS VQVELPEAVE SQNVSKEDKT        60
     PVILEVSGIG QYALSIGGER TEGITEELVT QLSKQEFDKD NNTLFLVGGA KDVPYEEVIK       120
     ALNLLHVAGI KSVGLMTNPL                                                   140
//

If you have problems or comments...

PBIL Back to PBIL home page