(data stored in ACNUC7421 zone)

EMBL: CP000947.PE132

CP000947.PE132       Location/Qualifiers
FT   CDS             142961..144016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0134"
FT                   /product="Tol-Pal system TolA"
FT                   /note="TIGRFAM: Tol-Pal system TolA; PFAM: TolA family
FT                   protein; KEGG: hso:HS_0261 TolA protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31076"
FT                   /db_xref="GOA:B0UVJ5"
FT                   /db_xref="InterPro:IPR014161"
FT                   /db_xref="UniProtKB/TrEMBL:B0UVJ5"
FT                   /protein_id="ACA31076.1"
FT                   /translation="MCNHRQKNELGAILLSIFLHILLLSLLVLGSNYNNVEIMGGGEGD
FT                   GEVMSAVMVDTGTIAKEWGRLQEKKKSNPDKQETFVEATQEDELMENVDVFEEKIREDE
FT                   DVQKRLAEQKIKEEKIQQERLAKQLEEDNAKKETVAKLKAEAEEMRLQALAKKIEEEKK
FT                   VRDAEEKQKVEKLAKERAEKLAKEKADRLAKQKALKEAKIKAEKAAKAKAELAQRKAEQ
FT                   AALDDFFNGGDIAGSSKNGGNMTMKGSQGVGAGFENGKGGRTGEQYAAQIKREIQRRFL
FT                   KEPRFANKVCVIEVELARDGTITNFRKLSGSDDICTAGLSAVSRTKKVPEAPTDEIYRK
FT                   YKKFPLEFRLK"
     MCNHRQKNEL GAILLSIFLH ILLLSLLVLG SNYNNVEIMG GGEGDGEVMS AVMVDTGTIA        60
     KEWGRLQEKK KSNPDKQETF VEATQEDELM ENVDVFEEKI REDEDVQKRL AEQKIKEEKI       120
     QQERLAKQLE EDNAKKETVA KLKAEAEEMR LQALAKKIEE EKKVRDAEEK QKVEKLAKER       180
     AEKLAKEKAD RLAKQKALKE AKIKAEKAAK AKAELAQRKA EQAALDDFFN GGDIAGSSKN       240
     GGNMTMKGSQ GVGAGFENGK GGRTGEQYAA QIKREIQRRF LKEPRFANKV CVIEVELARD       300
     GTITNFRKLS GSDDICTAGL SAVSRTKKVP EAPTDEIYRK YKKFPLEFRL K                351
//

If you have problems or comments...

PBIL Back to PBIL home page