(data stored in ACNUC7421 zone)

EMBL: CP000947.PE133

CP000947.PE133       Location/Qualifiers
FT   CDS             144044..145348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0135"
FT                   /product="Tol-Pal system beta propeller repeat TolB"
FT                   /note="TIGRFAM: Tol-Pal system beta propeller repeat TolB;
FT                   PFAM: TolB domain protein; WD40 domain protein beta
FT                   Propeller; KEGG: hso:HS_0262 biopolymer transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31085"
FT                   /db_xref="GOA:B0UVJ6"
FT                   /db_xref="InterPro:IPR007195"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="InterPro:IPR014167"
FT                   /db_xref="InterPro:IPR036752"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UVJ6"
FT                   /protein_id="ACA31085.1"
FT                   /translation="MKFSAYLTTLFIVLFSLFIQTVQAESEVRIVIDEGVDSARPIAII
FT                   PFKWNGSDSMPIDVADIISADLRNSGKFNPIAVSKMPQKPTSASEVISDVWSSLGIDAV
FT                   VVGQVTPNEKGYSIAYQLVDTIGASGNSGEVLSQNQYAVPKNAIRLGAHTISDEVFEKL
FT                   TAIRGAFRTKIAYVVQKNGGSKPYQVRIADYDGHNQFIVYSSSQPLMSPAWSPDGSKLA
FT                   YVSFENRKSQLIVHDLQSGARRVIAAFPGHNGAPAFSPDGSKIAFASSKDGVLNIYVMN
FT                   LGNGTISQLTSGAGNNTEPSWSPDGQSIIFTSDRAGGPQIYQMDVVGNGVSLVSAGRGY
FT                   SGKISADGSILVMIYGDNIVKKDLATGVTEMLSSTFLDESPSISPNGIMIIYSSTQGLG
FT                   KVLQLVSADGRFKARLPSSDGQIKFPAWSPYLNKN"
     MKFSAYLTTL FIVLFSLFIQ TVQAESEVRI VIDEGVDSAR PIAIIPFKWN GSDSMPIDVA        60
     DIISADLRNS GKFNPIAVSK MPQKPTSASE VISDVWSSLG IDAVVVGQVT PNEKGYSIAY       120
     QLVDTIGASG NSGEVLSQNQ YAVPKNAIRL GAHTISDEVF EKLTAIRGAF RTKIAYVVQK       180
     NGGSKPYQVR IADYDGHNQF IVYSSSQPLM SPAWSPDGSK LAYVSFENRK SQLIVHDLQS       240
     GARRVIAAFP GHNGAPAFSP DGSKIAFASS KDGVLNIYVM NLGNGTISQL TSGAGNNTEP       300
     SWSPDGQSII FTSDRAGGPQ IYQMDVVGNG VSLVSAGRGY SGKISADGSI LVMIYGDNIV       360
     KKDLATGVTE MLSSTFLDES PSISPNGIMI IYSSTQGLGK VLQLVSADGR FKARLPSSDG       420
     QIKFPAWSPY LNKN                                                         434
//

If you have problems or comments...

PBIL Back to PBIL home page