(data stored in ACNUC7421 zone)

EMBL: CP000947.PE134

CP000947.PE134       Location/Qualifiers
FT   CDS             145358..145813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0136"
FT                   /product="Peptidoglycan-associated lipoprotein"
FT                   /note="TIGRFAM: Peptidoglycan-associated lipoprotein; PFAM:
FT                   OmpA/MotB domain protein; KEGG: hso:HS_0263
FT                   peptidoglycan-associated outer membrane lipoprotein (outer
FT                   membrane protein P6)"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31096"
FT                   /db_xref="GOA:B0UVJ7"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR014169"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="InterPro:IPR039001"
FT                   /db_xref="UniProtKB/TrEMBL:B0UVJ7"
FT                   /protein_id="ACA31096.1"
FT                   /translation="MKNFAKLLVVAGSVAVLAACSSSDNASKTNAQMFGGYSVTDLQQR
FT                   YNTVYFEFDSYDVQGEYAQILDAHSAYLKSTPASKVLVEGHADERGTPEYNMALGLRRA
FT                   DAVKNFLLNKGVQASQLSTLSYGEEKPAELGHNEAAYSKNRRAVFAY"
     MKNFAKLLVV AGSVAVLAAC SSSDNASKTN AQMFGGYSVT DLQQRYNTVY FEFDSYDVQG        60
     EYAQILDAHS AYLKSTPASK VLVEGHADER GTPEYNMALG LRRADAVKNF LLNKGVQASQ       120
     LSTLSYGEEK PAELGHNEAA YSKNRRAVFA Y                                      151
//

If you have problems or comments...

PBIL Back to PBIL home page