(data stored in ACNUC7421 zone)

EMBL: CP000947.PE136

CP000947.PE136       Location/Qualifiers
FT   CDS             147028..147741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0138"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hso:HS_0265 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31118"
FT                   /db_xref="GOA:B0UVJ9"
FT                   /db_xref="InterPro:IPR016419"
FT                   /db_xref="UniProtKB/TrEMBL:B0UVJ9"
FT                   /protein_id="ACA31118.1"
FT                   /translation="MIIYRGQTLLSVMIALSLSMMLLMSVSAFYSYSQQQNKQILLHLY
FT                   LQSELQRTIQLLGKDIRRSGFRAISDKLVRSNFDLFAQDKSGKSIVVAQADNEPPNSCV
FT                   LFIYDLDATGCVGTTYRNNVCVRNKQNTAREIERELFGYRLNKQMIETRLTYKNSISAN
FT                   CNQKQCQSYLQQPACNSGGWVDLLDENDIAITALKFNWIADYNGLEVYLKGHLKRNKQV
FT                   EYETSAIIPLLNQKR"
     MIIYRGQTLL SVMIALSLSM MLLMSVSAFY SYSQQQNKQI LLHLYLQSEL QRTIQLLGKD        60
     IRRSGFRAIS DKLVRSNFDL FAQDKSGKSI VVAQADNEPP NSCVLFIYDL DATGCVGTTY       120
     RNNVCVRNKQ NTAREIEREL FGYRLNKQMI ETRLTYKNSI SANCNQKQCQ SYLQQPACNS       180
     GGWVDLLDEN DIAITALKFN WIADYNGLEV YLKGHLKRNK QVEYETSAII PLLNQKR          237
//

If you have problems or comments...

PBIL Back to PBIL home page