(data stored in ACNUC7421 zone)

EMBL: CP000947.PE137

CP000947.PE137       Location/Qualifiers
FT   CDS             147744..148424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0139"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hso:HS_0266 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31129"
FT                   /db_xref="GOA:B0UVK0"
FT                   /db_xref="InterPro:IPR022543"
FT                   /db_xref="UniProtKB/TrEMBL:B0UVK0"
FT                   /protein_id="ACA31129.1"
FT                   /translation="MNIQKGVVTLTLLMLLSSVLLILLFFDGDLISLHSSIVSQRKIYL
FT                   EQSLILQRQSISQKEKLCENQPLNNNLKSLKIEFESRRKIDRTSQFIWCERKYLFKKRP
FT                   KKATYEAGLSQYINLELLDLFQHKLHSPPAILPRDKANYLYWVEEKSAELEIQGNINAV
FT                   VIAEGDLKLTGKGKISGTVITGGKLSIEPAVKIVYRSKTIIDLIRSYSYWQFAENSWYD
FT                   FQPL"
     MNIQKGVVTL TLLMLLSSVL LILLFFDGDL ISLHSSIVSQ RKIYLEQSLI LQRQSISQKE        60
     KLCENQPLNN NLKSLKIEFE SRRKIDRTSQ FIWCERKYLF KKRPKKATYE AGLSQYINLE       120
     LLDLFQHKLH SPPAILPRDK ANYLYWVEEK SAELEIQGNI NAVVIAEGDL KLTGKGKISG       180
     TVITGGKLSI EPAVKIVYRS KTIIDLIRSY SYWQFAENSW YDFQPL                      226
//

If you have problems or comments...

PBIL Back to PBIL home page