(data stored in ACNUC7421 zone)

EMBL: CP000947.PE138

CP000947.PE138       Location/Qualifiers
FT   CDS             148405..148722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0140"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hso:HS_0267 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31141"
FT                   /db_xref="GOA:B0UVK1"
FT                   /db_xref="InterPro:IPR020511"
FT                   /db_xref="UniProtKB/TrEMBL:B0UVK1"
FT                   /protein_id="ACA31141.1"
FT                   /translation="MIFNHYKFPQRGTSLITLLVTMMIFSTLFLFVNQWVSYQRKSAVN
FT                   IYLRYQALQIAENQHQRLFLEPHFHCPHNIEQNGYKFKINCEGKNVRVSYANQQVNLLL
FT                   D"
     MIFNHYKFPQ RGTSLITLLV TMMIFSTLFL FVNQWVSYQR KSAVNIYLRY QALQIAENQH        60
     QRLFLEPHFH CPHNIEQNGY KFKINCEGKN VRVSYANQQV NLLLD                       105
//

If you have problems or comments...

PBIL Back to PBIL home page