(data stored in ACNUC7421 zone)

EMBL: CP000947.PE139

CP000947.PE139       Location/Qualifiers
FT   CDS             148775..152209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0141"
FT                   /product="exodeoxyribonuclease V, gamma subunit"
FT                   /note="TIGRFAM: exodeoxyribonuclease V, gamma subunit;
FT                   PFAM: Exodeoxyribonuclease V RecC subunit; KEGG:
FT                   hso:HS_0268 exodeoxyribonuclease V, gamma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31152"
FT                   /db_xref="GOA:B0UVK2"
FT                   /db_xref="InterPro:IPR006697"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041500"
FT                   /db_xref="UniProtKB/TrEMBL:B0UVK2"
FT                   /protein_id="ACA31152.1"
FT                   /translation="MFTLYYSNQLETQKDILLHLMDQQPLSDPFQKEVILVQSGGMAQW
FT                   IQWQIAEKKGISANLSFPMPASFIWQLYVDNLSQVTASSQFSKENMTWRLMEIIPHYID
FT                   QPEFYILRQYLQQSYQSSQQRYYQLASKIAELFDQYLVYRPEWIISWEQNKGVEIIQQI
FT                   QYYQKNLSVSESCFSQVEQHIVWQGILWRALVCSVQKETQKNVLHRAHLHLLFLKHIAG
FT                   EKPKNLPTRIFVFGISALPKVHLDTLSALSQHCDVHLFFNNACREYWGDIIDQSHWQRL
FT                   KVRERISWQDFQQPQNTQAWLSDAQIHTFEQNGFEQIYDEKLQVGNPLLSSWGKLGRDY
FT                   LYLLTELEANEINAYVELSEKTLLSQVQARILDLVPSKHKFLNLAENDRSLTFHSCYSP
FT                   IREVQALQDYLLHLFNQAQDLTPKDVVVMVADIDKYAPYIQAVFSQGEHYIPYSIADSK
FT                   LSENDPLVSAFLQLLNLKESLFSAEEVLTFLDHPVIRQSFNITLEDLAQIRHWVEHSGI
FT                   RFGLEKYPQQSLQNYNAWQAGLERMLLGFAMREENGLWLDTLGFDDTYGLKGQLVGYLK
FT                   DFITRLYQWHQFLQVDHVIEKWEEHLIELMSSFFVVDGMDIPQQYKTTFNYLIDTIQQL
FT                   TELILDSSFQQEISAEVIYEVFVERLKDIPNSLKFLMGKVTFCTLLPMRSIPFKVVCLL
FT                   GMNDSDYPRQQTPNSFDLMQYHRKKGDRFRRDDDRYLFLEALISAQQYFYVSYIGRSII
FT                   DDSEREPSVLVTQLLDYIAENINAQGDLKGQDILKKSLIQQHAMTAFSRENFTKRDRSF
FT                   SKQWLVLANKKDSGNLANFLQPINDTEIVKELSLNDLIAFIQDPVRYFFEQKLRVFLRK
FT                   TEQNIADTENFTLDNLELYQIKEELIYLSEQEWEDFFARMKIKGIMPQGAFAKIYQQKT
FT                   KNEIITLKSLVTPYLDQISEQIPVDLSVETEYGKVCLTGSIDSLYHQKMRRVTWRASVV
FT                   KTKDIIQTWIYYLLQTLVGEPNSQVEHYALDSRLSFEKIEKSTALQQLQTYVEAYLLGQ
FT                   VSVLLMPMKNFDQYLQLLFTPKSNKWKEEKDIDLSACFELLSELGSGRKERNFYVKTDP
FT                   YWQRILAQTKLDDSHILEINQRVIQWFDLMLMLKRVE"
     MFTLYYSNQL ETQKDILLHL MDQQPLSDPF QKEVILVQSG GMAQWIQWQI AEKKGISANL        60
     SFPMPASFIW QLYVDNLSQV TASSQFSKEN MTWRLMEIIP HYIDQPEFYI LRQYLQQSYQ       120
     SSQQRYYQLA SKIAELFDQY LVYRPEWIIS WEQNKGVEII QQIQYYQKNL SVSESCFSQV       180
     EQHIVWQGIL WRALVCSVQK ETQKNVLHRA HLHLLFLKHI AGEKPKNLPT RIFVFGISAL       240
     PKVHLDTLSA LSQHCDVHLF FNNACREYWG DIIDQSHWQR LKVRERISWQ DFQQPQNTQA       300
     WLSDAQIHTF EQNGFEQIYD EKLQVGNPLL SSWGKLGRDY LYLLTELEAN EINAYVELSE       360
     KTLLSQVQAR ILDLVPSKHK FLNLAENDRS LTFHSCYSPI REVQALQDYL LHLFNQAQDL       420
     TPKDVVVMVA DIDKYAPYIQ AVFSQGEHYI PYSIADSKLS ENDPLVSAFL QLLNLKESLF       480
     SAEEVLTFLD HPVIRQSFNI TLEDLAQIRH WVEHSGIRFG LEKYPQQSLQ NYNAWQAGLE       540
     RMLLGFAMRE ENGLWLDTLG FDDTYGLKGQ LVGYLKDFIT RLYQWHQFLQ VDHVIEKWEE       600
     HLIELMSSFF VVDGMDIPQQ YKTTFNYLID TIQQLTELIL DSSFQQEISA EVIYEVFVER       660
     LKDIPNSLKF LMGKVTFCTL LPMRSIPFKV VCLLGMNDSD YPRQQTPNSF DLMQYHRKKG       720
     DRFRRDDDRY LFLEALISAQ QYFYVSYIGR SIIDDSEREP SVLVTQLLDY IAENINAQGD       780
     LKGQDILKKS LIQQHAMTAF SRENFTKRDR SFSKQWLVLA NKKDSGNLAN FLQPINDTEI       840
     VKELSLNDLI AFIQDPVRYF FEQKLRVFLR KTEQNIADTE NFTLDNLELY QIKEELIYLS       900
     EQEWEDFFAR MKIKGIMPQG AFAKIYQQKT KNEIITLKSL VTPYLDQISE QIPVDLSVET       960
     EYGKVCLTGS IDSLYHQKMR RVTWRASVVK TKDIIQTWIY YLLQTLVGEP NSQVEHYALD      1020
     SRLSFEKIEK STALQQLQTY VEAYLLGQVS VLLMPMKNFD QYLQLLFTPK SNKWKEEKDI      1080
     DLSACFELLS ELGSGRKERN FYVKTDPYWQ RILAQTKLDD SHILEINQRV IQWFDLMLML      1140
     KRVE                                                                   1144
//

If you have problems or comments...

PBIL Back to PBIL home page