(data stored in ACNUC7421 zone)

EMBL: CP000947.PE14

CP000947.PE14        Location/Qualifiers
FT   CDS             11318..11536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0014"
FT                   /product="acetohydroxy acid synthase II, small subunit"
FT                   /note="KEGG: hso:HS_0148 acetohydroxy acid synthase II,
FT                   small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31140"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="UniProtKB/TrEMBL:B0UUX2"
FT                   /protein_id="ACA31140.1"
FT                   /translation="MKTYDLTIQANKRPETLERLLRVVRHRGFEVIILHSESKGNVIDL
FT                   RLTVQSERAIELLIHQLVKLPDVITLS"
     MKTYDLTIQA NKRPETLERL LRVVRHRGFE VIILHSESKG NVIDLRLTVQ SERAIELLIH        60
     QLVKLPDVIT LS                                                            72
//

If you have problems or comments...

PBIL Back to PBIL home page