(data stored in ACNUC7421 zone)

EMBL: CP000947.PE140

CP000947.PE140       Location/Qualifiers
FT   CDS             152288..152902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0142"
FT                   /product="Holliday junction DNA helicase RuvA"
FT                   /note="TIGRFAM: Holliday junction DNA helicase RuvA; PFAM:
FT                   RuvA domain protein; DNA recombination protein RuvA domain
FT                   I; SMART: Helix-hairpin-helix DNA-binding class 1; KEGG:
FT                   hso:HS_0269 Holliday junction DNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31163"
FT                   /db_xref="GOA:B0UVK3"
FT                   /db_xref="InterPro:IPR000085"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR011114"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013849"
FT                   /db_xref="InterPro:IPR036267"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UVK3"
FT                   /protein_id="ACA31163.1"
FT                   /translation="MIGRVTGILVEKQAPEILLDVQGVGYELLLPMTSFYNLPEVGQET
FT                   TLFTHFVVREDAHLLFGFSHKQDRSLFRELIKTNGVGPKLALAILSAMSVNEFVYAIEQ
FT                   EELSKLVKIPGVGKKTAERLLVELKGKFKGLQQTDFFIKSSHLPGIKCSKLDQSLQLDE
FT                   AVSALIALGYKPIEAEKMVKKVLKADLTSEQLIREALKAAL"
     MIGRVTGILV EKQAPEILLD VQGVGYELLL PMTSFYNLPE VGQETTLFTH FVVREDAHLL        60
     FGFSHKQDRS LFRELIKTNG VGPKLALAIL SAMSVNEFVY AIEQEELSKL VKIPGVGKKT       120
     AERLLVELKG KFKGLQQTDF FIKSSHLPGI KCSKLDQSLQ LDEAVSALIA LGYKPIEAEK       180
     MVKKVLKADL TSEQLIREAL KAAL                                              204
//

If you have problems or comments...

PBIL Back to PBIL home page