(data stored in ACNUC7421 zone)

EMBL: CP000947.PE141

CP000947.PE141       Location/Qualifiers
FT   CDS             152913..153920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0143"
FT                   /product="Holliday junction DNA helicase RuvB"
FT                   /note="TIGRFAM: Holliday junction DNA helicase RuvB; PFAM:
FT                   AAA ATPase central domain protein; Holliday junction DNA
FT                   helicase RuvB domain; ATPase associated with various
FT                   cellular activities AAA_5; SMART: AAA ATPase; KEGG:
FT                   hso:HS_0270 Holliday junction DNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31174"
FT                   /db_xref="GOA:B0UVK4"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004605"
FT                   /db_xref="InterPro:IPR008823"
FT                   /db_xref="InterPro:IPR008824"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR041445"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UVK4"
FT                   /protein_id="ACA31174.1"
FT                   /translation="MIEVDRIVSANAKVDDEYIDRAIRPKLLSDYIGQPQVREQMEIFI
FT                   QAAKLRQDALDHLLIFGPPGLGKTTLANIVANEMGVNIRTTSGPVLEKAGDLAAMLTNL
FT                   EPHDVLFIDEIHRLSPAIEEVLYPAMEDYQLDIMIGEGPAARSIKLDLPPFTLIGATTR
FT                   AGSLTSPLRDRFGIVQRLEFYSVEDLASIVTRSAVCLQLEIDVEAGQEIACRSRGTPRI
FT                   ANRLLRRVRDYADVKNGGKITALIAQEALKMLDVDLAGFDFMDRKLLQAIIERFDGGPV
FT                   GLDNLAAAIGEERDTIEDVLEPYLIQQGFLQRTPRGRIATSRTYRHFGLEQIEK"
     MIEVDRIVSA NAKVDDEYID RAIRPKLLSD YIGQPQVREQ MEIFIQAAKL RQDALDHLLI        60
     FGPPGLGKTT LANIVANEMG VNIRTTSGPV LEKAGDLAAM LTNLEPHDVL FIDEIHRLSP       120
     AIEEVLYPAM EDYQLDIMIG EGPAARSIKL DLPPFTLIGA TTRAGSLTSP LRDRFGIVQR       180
     LEFYSVEDLA SIVTRSAVCL QLEIDVEAGQ EIACRSRGTP RIANRLLRRV RDYADVKNGG       240
     KITALIAQEA LKMLDVDLAG FDFMDRKLLQ AIIERFDGGP VGLDNLAAAI GEERDTIEDV       300
     LEPYLIQQGF LQRTPRGRIA TSRTYRHFGL EQIEK                                  335
//

If you have problems or comments...

PBIL Back to PBIL home page