(data stored in ACNUC7421 zone)

EMBL: CP000947.PE142

CP000947.PE142       Location/Qualifiers
FT   CDS             complement(154034..155242)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0144"
FT                   /product="HI0933 family protein"
FT                   /note="PFAM: HI0933 family protein; FAD dependent
FT                   oxidoreductase; KEGG: hso:HS_0271 conserved hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31185"
FT                   /db_xref="InterPro:IPR004792"
FT                   /db_xref="InterPro:IPR023166"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B0UVK5"
FT                   /protein_id="ACA31185.1"
FT                   /translation="MMNYSQTIIIGAGAAGLFCAGQLGKAKHQVTILDNGKKVGRKILM
FT                   SGGGFCNFTNLNVTPQHYLSQNPHFVKSALARFTQWDFIALITDYGISYYEKESGQLFC
FT                   HNSAEDIVNMLRAECDKFQVNTQLRQQIEYIEKLDGNEKARFQLQSDGKIWQCENLVIA
FT                   TGGLSMPALSSTPFGYQVAEQFGLNVIAPRAGLVPFTWREIDKFYTALSGISLPVCVTA
FT                   KCGQSFSNNLLFTHRGISGPAILQISNYWQVNENIEIDLLPMENIQFFLNKLRQTSPKL
FT                   HLKTALSRLLPQKLVDLWLNHNIIQDEVIANLSKVQLKNLDDLIHHWQIQPNGTEGYRT
FT                   AEVTIGGVDTQEISSKTMESHKIKGLYFIGEVLDVTGRLGGYNFQWAWSSAYVCANGIL
FT                   SNK"
     MMNYSQTIII GAGAAGLFCA GQLGKAKHQV TILDNGKKVG RKILMSGGGF CNFTNLNVTP        60
     QHYLSQNPHF VKSALARFTQ WDFIALITDY GISYYEKESG QLFCHNSAED IVNMLRAECD       120
     KFQVNTQLRQ QIEYIEKLDG NEKARFQLQS DGKIWQCENL VIATGGLSMP ALSSTPFGYQ       180
     VAEQFGLNVI APRAGLVPFT WREIDKFYTA LSGISLPVCV TAKCGQSFSN NLLFTHRGIS       240
     GPAILQISNY WQVNENIEID LLPMENIQFF LNKLRQTSPK LHLKTALSRL LPQKLVDLWL       300
     NHNIIQDEVI ANLSKVQLKN LDDLIHHWQI QPNGTEGYRT AEVTIGGVDT QEISSKTMES       360
     HKIKGLYFIG EVLDVTGRLG GYNFQWAWSS AYVCANGILS NK                          402
//

If you have problems or comments...

PBIL Back to PBIL home page