(data stored in ACNUC7421 zone)

EMBL: CP000947.PE145

CP000947.PE145       Location/Qualifiers
FT   CDS             157852..159330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0147"
FT                   /product="ribonuclease, Rne/Rng family"
FT                   /note="TIGRFAM: ribonuclease, Rne/Rng family; PFAM: RNA
FT                   binding S1 domain protein; KEGG: hso:HS_0274 ribonuclease
FT                   G"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31218"
FT                   /db_xref="GOA:B0UVK8"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004659"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019307"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:B0UVK8"
FT                   /protein_id="ACA31218.1"
FT                   /translation="MMESVELLANITPSETRIALVDNGILKEVHIERQAKRGSVGNIYK
FT                   GRVTRVLPGMQSAFVDIGLEKAAFLHASDIVSHTECVDVDEQKQFVVKDIAQLVHEGQD
FT                   IVVQVVKDPLGTKGARLTTDITLPSRYLVFMPENSHVGVSQRIESEEERARLKELVLPL
FT                   CDELGGFIIRTAAEGATETELVQDAEFLKRLWRKVLERRAKYTTRSMLYGELALTQRIL
FT                   RDFIGANFSKIHIDSKLCFSEVKQFTEEFMPELTDKLVLYSGSQPLFDVYSVENAIQTA
FT                   LNSRVNLKSGGYLIIEQTESMTTIDINTGAFVGHRNLEETIFNTNIEATKAIAQQLQLR
FT                   NLGGIIIIDFIDMQTEEHRDRVLESLRLALSKDRVKTNVNGFTQLGLVEMTRKRTRESL
FT                   EHILCDECPTCSGRGSVKTVETVCYEIMREIIRVNHLFASEKFVVYASRAVADYLINEE
FT                   SHGLLAELEVFIGKQIQIKTEVYYSQEQFDVVVM"
     MMESVELLAN ITPSETRIAL VDNGILKEVH IERQAKRGSV GNIYKGRVTR VLPGMQSAFV        60
     DIGLEKAAFL HASDIVSHTE CVDVDEQKQF VVKDIAQLVH EGQDIVVQVV KDPLGTKGAR       120
     LTTDITLPSR YLVFMPENSH VGVSQRIESE EERARLKELV LPLCDELGGF IIRTAAEGAT       180
     ETELVQDAEF LKRLWRKVLE RRAKYTTRSM LYGELALTQR ILRDFIGANF SKIHIDSKLC       240
     FSEVKQFTEE FMPELTDKLV LYSGSQPLFD VYSVENAIQT ALNSRVNLKS GGYLIIEQTE       300
     SMTTIDINTG AFVGHRNLEE TIFNTNIEAT KAIAQQLQLR NLGGIIIIDF IDMQTEEHRD       360
     RVLESLRLAL SKDRVKTNVN GFTQLGLVEM TRKRTRESLE HILCDECPTC SGRGSVKTVE       420
     TVCYEIMREI IRVNHLFASE KFVVYASRAV ADYLINEESH GLLAELEVFI GKQIQIKTEV       480
     YYSQEQFDVV VM                                                           492
//

If you have problems or comments...

PBIL Back to PBIL home page