(data stored in ACNUC7421 zone)

EMBL: CP000947.PE15

CP000947.PE15        Location/Qualifiers
FT   CDS             11602..12264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0015"
FT                   /product="MOSC domain containing protein"
FT                   /note="PFAM: MOSC domain containing protein; KEGG:
FT                   hso:HS_0149 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31251"
FT                   /db_xref="GOA:B0UUX3"
FT                   /db_xref="InterPro:IPR005302"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="UniProtKB/TrEMBL:B0UUX3"
FT                   /protein_id="ACA31251.1"
FT                   /translation="MEGAVLAIKLGLVEEIVFENGSKMSTAIRKKPMEQAIVHELGAEG
FT                   NDVGLKAHHGGIDKALFFMAERSFAKLTALLGKHDSYQGEAIYGENFIVSFFDEENVCV
FT                   GDQYQIGDVQIEISQPRIPCETLSKNANNKNTRAIVVETGLTGWYVRVIKNGVIKKGDK
FT                   IRRLANPYPKLTIKYLNYLLATEATVELKTQLEQAIECPVLAEAFKRYLKMKWRKIS"
     MEGAVLAIKL GLVEEIVFEN GSKMSTAIRK KPMEQAIVHE LGAEGNDVGL KAHHGGIDKA        60
     LFFMAERSFA KLTALLGKHD SYQGEAIYGE NFIVSFFDEE NVCVGDQYQI GDVQIEISQP       120
     RIPCETLSKN ANNKNTRAIV VETGLTGWYV RVIKNGVIKK GDKIRRLANP YPKLTIKYLN       180
     YLLATEATVE LKTQLEQAIE CPVLAEAFKR YLKMKWRKIS                             220
//

If you have problems or comments...

PBIL Back to PBIL home page