(data stored in ACNUC7421 zone)

EMBL: CP000947.PE151

CP000947.PE151       Location/Qualifiers
FT   CDS             165268..165675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0153"
FT                   /product="transcriptional regulator, BadM/Rrf2 family"
FT                   /note="TIGRFAM: putative transcriptional regulator, Rrf2
FT                   family; iron-sulfur cluster assembly transcription factor
FT                   IscR; PFAM: protein of unknown function UPF0074; KEGG:
FT                   hso:HS_0280 possible transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31285"
FT                   /db_xref="GOA:B0UVL4"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR010242"
FT                   /db_xref="InterPro:IPR030489"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B0UVL4"
FT                   /protein_id="ACA31285.1"
FT                   /translation="MKLTSKGRYAVTAILDIALNAELGPVSLADISERQHISLSYLEQL
FT                   FAKLRRGGLVKSVRGPGGGYQLGLSTDQISIGMVINAVNENINVTKCLGNGDCQGGVKC
FT                   LTHSLWEELSVRIENFLNEITIAELVAKQAK"
     MKLTSKGRYA VTAILDIALN AELGPVSLAD ISERQHISLS YLEQLFAKLR RGGLVKSVRG        60
     PGGGYQLGLS TDQISIGMVI NAVNENINVT KCLGNGDCQG GVKCLTHSLW EELSVRIENF       120
     LNEITIAELV AKQAK                                                        135
//

If you have problems or comments...

PBIL Back to PBIL home page