(data stored in ACNUC7421 zone)

EMBL: CP000947.PE152

CP000947.PE152       Location/Qualifiers
FT   CDS             165754..166968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0154"
FT                   /product="cysteine desulfurase IscS"
FT                   /note="TIGRFAM: cysteine desulfurase IscS; PFAM:
FT                   aminotransferase class V; aromatic amino acid
FT                   beta-eliminating lyase/threonine aldolase; KEGG:
FT                   hso:HS_0281 cysteine desulfurase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31296"
FT                   /db_xref="GOA:B0UVL5"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR010240"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR016454"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UVL5"
FT                   /protein_id="ACA31296.1"
FT                   /translation="MKLPIYLDYAATCPVDERVVKKMMEFLSIDGNFGNPASRSHKFGW
FT                   QAEEAVDVARNHIADLIGADSREIVFTSGATEADNLALKGVMRFYQTKGKHLITCKTEH
FT                   KAILDTCRQLEREGFEVTYLDPKSDGLIDLEELKSVIRDDTVLVSIMHANNEIGVVQDI
FT                   AKIGEICRERKVLFHTDATQSVGKLPINLSELKVDLLSMSSHKLYGPKGIGALYVCRKP
FT                   RVRLEAIIHGGGHERGMRSGTLPVHQIVGMGEAYRIAKEEMATEMPRLTALRDRLYNGL
FT                   KDIEETYVNGSMEQRLGNNLNISFNYVEGESLMMALRDIAVSSGSACTSASLEPSYVLR
FT                   ALGLNDELAHSSIRFTVGRYTTEEEIDYSIGLVKSAVKKLRDLSPLWDMFKEGIDLNSI
FT                   EWTHH"
     MKLPIYLDYA ATCPVDERVV KKMMEFLSID GNFGNPASRS HKFGWQAEEA VDVARNHIAD        60
     LIGADSREIV FTSGATEADN LALKGVMRFY QTKGKHLITC KTEHKAILDT CRQLEREGFE       120
     VTYLDPKSDG LIDLEELKSV IRDDTVLVSI MHANNEIGVV QDIAKIGEIC RERKVLFHTD       180
     ATQSVGKLPI NLSELKVDLL SMSSHKLYGP KGIGALYVCR KPRVRLEAII HGGGHERGMR       240
     SGTLPVHQIV GMGEAYRIAK EEMATEMPRL TALRDRLYNG LKDIEETYVN GSMEQRLGNN       300
     LNISFNYVEG ESLMMALRDI AVSSGSACTS ASLEPSYVLR ALGLNDELAH SSIRFTVGRY       360
     TTEEEIDYSI GLVKSAVKKL RDLSPLWDMF KEGIDLNSIE WTHH                        404
//

If you have problems or comments...

PBIL Back to PBIL home page