(data stored in ACNUC7421 zone)

EMBL: CP000947.PE153

CP000947.PE153       Location/Qualifiers
FT   CDS             167045..167428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0155"
FT                   /product="FeS cluster assembly scaffold IscU"
FT                   /note="TIGRFAM: FeS cluster assembly scaffold IscU; PFAM:
FT                   nitrogen-fixing NifU domain protein; KEGG: hso:HS_0282
FT                   iron-sulfur cofactor synthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31307"
FT                   /db_xref="GOA:B0UVL6"
FT                   /db_xref="InterPro:IPR002871"
FT                   /db_xref="InterPro:IPR011339"
FT                   /db_xref="UniProtKB/TrEMBL:B0UVL6"
FT                   /protein_id="ACA31307.1"
FT                   /translation="MAYSEKLLDHYENPRNVGSFDKKDPTVGSGMVGAPACGDVMQLQI
FT                   KVNDEGIIEDAKFKTYGCGSAIASSSLITEWVKGKSLDEAQAIKNSQIAEELELPPVKV
FT                   HCSILAEDAIKAAIADYKAKKAE"
     MAYSEKLLDH YENPRNVGSF DKKDPTVGSG MVGAPACGDV MQLQIKVNDE GIIEDAKFKT        60
     YGCGSAIASS SLITEWVKGK SLDEAQAIKN SQIAEELELP PVKVHCSILA EDAIKAAIAD       120
     YKAKKAE                                                                 127
//

If you have problems or comments...

PBIL Back to PBIL home page