(data stored in ACNUC7421 zone)

EMBL: CP000947.PE154

CP000947.PE154       Location/Qualifiers
FT   CDS             167594..167917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0156"
FT                   /product="iron-sulfur cluster assembly protein IscA"
FT                   /note="TIGRFAM: iron-sulfur cluster assembly accessory
FT                   protein; iron-sulfur cluster assembly protein IscA; PFAM:
FT                   HesB/YadR/YfhF-family protein; KEGG: hso:HS_0283
FT                   HesB-family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31318"
FT                   /db_xref="GOA:B0UVL7"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR011302"
FT                   /db_xref="InterPro:IPR016092"
FT                   /db_xref="InterPro:IPR017870"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/TrEMBL:B0UVL7"
FT                   /protein_id="ACA31318.1"
FT                   /translation="MSITLTQAAANRVRTFLEKRGKGIGLRLGIKTSGCSGLAYVLEFV
FT                   DVLNEDDEVFEQDGVKVIVDHKSLVYLDGTQLDFVKEGLNEGFKFSNPNVKDECGCGES
FT                   FNV"
     MSITLTQAAA NRVRTFLEKR GKGIGLRLGI KTSGCSGLAY VLEFVDVLNE DDEVFEQDGV        60
     KVIVDHKSLV YLDGTQLDFV KEGLNEGFKF SNPNVKDECG CGESFNV                     107
//

If you have problems or comments...

PBIL Back to PBIL home page