(data stored in ACNUC7421 zone)

EMBL: CP000947.PE155

CP000947.PE155       Location/Qualifiers
FT   CDS             167930..168448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0157"
FT                   /product="co-chaperone Hsc20"
FT                   /note="TIGRFAM: co-chaperone Hsc20; PFAM: heat shock
FT                   protein DnaJ domain protein; HSCB oligomerisation domain
FT                   protein; KEGG: hso:HS_0284 co-chaperone protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31329"
FT                   /db_xref="GOA:B0UVL8"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR004640"
FT                   /db_xref="InterPro:IPR009073"
FT                   /db_xref="InterPro:IPR036386"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:B0UVL8"
FT                   /protein_id="ACA31329.1"
FT                   /translation="MINPFALFDLEIDFNLDQQILSQRYLTLQKSLHPDNFAHRSAQEQ
FT                   RLALQKSAEINDALQILKDPISRADSIINLHLGEQNIEQKTNQDMMFLMQQMAWRERLE
FT                   QVEQQQNMDKLLHFSQEVECVQRDILAELQEFLAQQNWQQAQLLNDRLRFIKKLFVEIE
FT                   RVEEQLAGF"
     MINPFALFDL EIDFNLDQQI LSQRYLTLQK SLHPDNFAHR SAQEQRLALQ KSAEINDALQ        60
     ILKDPISRAD SIINLHLGEQ NIEQKTNQDM MFLMQQMAWR ERLEQVEQQQ NMDKLLHFSQ       120
     EVECVQRDIL AELQEFLAQQ NWQQAQLLND RLRFIKKLFV EIERVEEQLA GF               172
//

If you have problems or comments...

PBIL Back to PBIL home page