(data stored in ACNUC7421 zone)

EMBL: CP000947.PE156

CP000947.PE156       Location/Qualifiers
FT   CDS             168490..170340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0158"
FT                   /product="Fe-S protein assembly chaperone HscA"
FT                   /EC_number="1.3.1.74"
FT                   /note="TIGRFAM: Fe-S protein assembly chaperone HscA; PFAM:
FT                   Heat shock protein 70; KEGG: hso:HS_0285 chaperone protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31340"
FT                   /db_xref="GOA:B0UVL9"
FT                   /db_xref="InterPro:IPR010236"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="InterPro:IPR042039"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UVL9"
FT                   /protein_id="ACA31340.1"
FT                   /translation="MALLQIAEPGQSAAPHQHKLAVGIDLGTTNSLVAAVRSGSSEVLR
FT                   DEQDRLLIPSIVHLTEDQAIVGYEAGQLASQDPQNTIISVKRLIGRSCTDVQQRYPNLP
FT                   YQFNATENGLPLLKTRRGLLSPVEISAEILKKLTALAEQRLGGELTGAVITVPAYFDDA
FT                   QRQSTKDAAKLAGLKVLRLLNEPTAAAIAYGLDSGQEGVIAVYDLGGGTFDVSILRLSK
FT                   GVFEVLATGGDTALGGDDFDHLLAEWIVKKSTVAPQNDREKRQLIEVANQVKVALTTND
FT                   KIRISYAEQNLEIMRDEFNFLISGLVKRSLLACRRTLKDANLTPSDILEVVMVGGSTRI
FT                   PYVREQVGEFFQCTPLTSIDPDKVVALGAAIQADILVGNKPDSEMLLLDVIPLSLGIET
FT                   MGGLVEKIIPRNTTIPVARAQEFTTFKDGQTAMSVHVLQGEREMVTDCRSLARFTLRGI
FT                   PAMVAGAARIRVTYQVDADGLLSVTAVEKSTGVQASTQVKPSYGLTDDEIANMLKSSME
FT                   HAKEDIQTRLLTEQRVDATRVIESVYSALQQDEDLLDDNELSAVKNALVSLQKLIQEED
FT                   SLAIKQGIKMLDQATQEFASRRMDKSIRRALSGQHIEHIK"
     MALLQIAEPG QSAAPHQHKL AVGIDLGTTN SLVAAVRSGS SEVLRDEQDR LLIPSIVHLT        60
     EDQAIVGYEA GQLASQDPQN TIISVKRLIG RSCTDVQQRY PNLPYQFNAT ENGLPLLKTR       120
     RGLLSPVEIS AEILKKLTAL AEQRLGGELT GAVITVPAYF DDAQRQSTKD AAKLAGLKVL       180
     RLLNEPTAAA IAYGLDSGQE GVIAVYDLGG GTFDVSILRL SKGVFEVLAT GGDTALGGDD       240
     FDHLLAEWIV KKSTVAPQND REKRQLIEVA NQVKVALTTN DKIRISYAEQ NLEIMRDEFN       300
     FLISGLVKRS LLACRRTLKD ANLTPSDILE VVMVGGSTRI PYVREQVGEF FQCTPLTSID       360
     PDKVVALGAA IQADILVGNK PDSEMLLLDV IPLSLGIETM GGLVEKIIPR NTTIPVARAQ       420
     EFTTFKDGQT AMSVHVLQGE REMVTDCRSL ARFTLRGIPA MVAGAARIRV TYQVDADGLL       480
     SVTAVEKSTG VQASTQVKPS YGLTDDEIAN MLKSSMEHAK EDIQTRLLTE QRVDATRVIE       540
     SVYSALQQDE DLLDDNELSA VKNALVSLQK LIQEEDSLAI KQGIKMLDQA TQEFASRRMD       600
     KSIRRALSGQ HIEHIK                                                       616
//

If you have problems or comments...

PBIL Back to PBIL home page