(data stored in ACNUC7421 zone)

EMBL: CP000947.PE158

CP000947.PE158       Location/Qualifiers
FT   CDS             170828..173101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0160"
FT                   /product="glutamate--cysteine ligase, putative/amino acid
FT                   ligase, putative"
FT                   /EC_number="6.3.2.3"
FT                   /note="TIGRFAM: glutamate--cysteine ligase, putative/amino
FT                   acid ligase, putative; PFAM: phosphoribosylglycinamide
FT                   synthetase; glutamate--cysteine ligase; KEGG: hso:HS_0287
FT                   glutamate--cysteine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31363"
FT                   /db_xref="GOA:B0UVM1"
FT                   /db_xref="InterPro:IPR006334"
FT                   /db_xref="InterPro:IPR006335"
FT                   /db_xref="InterPro:IPR007370"
FT                   /db_xref="InterPro:IPR011095"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR040657"
FT                   /db_xref="UniProtKB/TrEMBL:B0UVM1"
FT                   /protein_id="ACA31363.1"
FT                   /translation="MKIQHLIKQHQLGLLFQQGSFGLEKESQRVYQDGSVVTTEHPKCF
FT                   GNRSYHPYIQTDFAESQLELITPPNKNLEDSLRWLSAIHEVVLRSLPEDEFIFPLSMPA
FT                   GLPSDELIKVAQLDNPEDVAYREHLVQSYGKNKQMVSGIHYNFQLAPELIQTLFDLQQE
FT                   QKSAVDFQNNLYLKMAKNFLRYQWVLLYLLSATPTVESNYFKGSSPLGKGEYVRSLRSS
FT                   KYGYVNDPEVIVSFDSLEQYAESLEHWVKSGKLIAEKEFYSNVRLRGAKKARDLIQNGI
FT                   KYLEFRLFDLNPFEQYGMSLADARFIHHFVLLMIWLDEMPDQQGVELGRSRLAEVALEN
FT                   PLAQTAYREEGEWLLNQLISMLQSIGADQSAVSFVREKLAQFADPGLTLCGRLVQEIEQ
FT                   KGGYQKLGAELAKQYKENAFERFYALTAFDNMELSTQALMFDLIQQGISFEILDERDQF
FT                   LRLQFGEHVEYVKNGNMTSKDSYISPLIMENKVVTKKVLEKAGFNVPQSQEFTSVKQAI
FT                   VGYSLFEKRAVVIKPKSTNYGLGITIFQQGVNNREDFAKAVEIAFREDKEIMVEDYLVG
FT                   TEYRFFVLGEETLAVLLRVPANVVGDGIHTVAELVAQKNAHSLRGDGSRTPLKKIALGD
FT                   IEQLQLKEQGLTVESIPAKDQIVQLRANSNISTGGDSIDITDEMHLSYKQLAVGIAKAM
FT                   GAAVCGVDLIISDLKEPAQPDLSSWGVIEANFNPMMMMHIFPYAGQSRRLTRNVINMLF
FT                   PEVK"
     MKIQHLIKQH QLGLLFQQGS FGLEKESQRV YQDGSVVTTE HPKCFGNRSY HPYIQTDFAE        60
     SQLELITPPN KNLEDSLRWL SAIHEVVLRS LPEDEFIFPL SMPAGLPSDE LIKVAQLDNP       120
     EDVAYREHLV QSYGKNKQMV SGIHYNFQLA PELIQTLFDL QQEQKSAVDF QNNLYLKMAK       180
     NFLRYQWVLL YLLSATPTVE SNYFKGSSPL GKGEYVRSLR SSKYGYVNDP EVIVSFDSLE       240
     QYAESLEHWV KSGKLIAEKE FYSNVRLRGA KKARDLIQNG IKYLEFRLFD LNPFEQYGMS       300
     LADARFIHHF VLLMIWLDEM PDQQGVELGR SRLAEVALEN PLAQTAYREE GEWLLNQLIS       360
     MLQSIGADQS AVSFVREKLA QFADPGLTLC GRLVQEIEQK GGYQKLGAEL AKQYKENAFE       420
     RFYALTAFDN MELSTQALMF DLIQQGISFE ILDERDQFLR LQFGEHVEYV KNGNMTSKDS       480
     YISPLIMENK VVTKKVLEKA GFNVPQSQEF TSVKQAIVGY SLFEKRAVVI KPKSTNYGLG       540
     ITIFQQGVNN REDFAKAVEI AFREDKEIMV EDYLVGTEYR FFVLGEETLA VLLRVPANVV       600
     GDGIHTVAEL VAQKNAHSLR GDGSRTPLKK IALGDIEQLQ LKEQGLTVES IPAKDQIVQL       660
     RANSNISTGG DSIDITDEMH LSYKQLAVGI AKAMGAAVCG VDLIISDLKE PAQPDLSSWG       720
     VIEANFNPMM MMHIFPYAGQ SRRLTRNVIN MLFPEVK                                757
//

If you have problems or comments...

PBIL Back to PBIL home page