(data stored in ACNUC7421 zone)

EMBL: CP000947.PE160

CP000947.PE160       Location/Qualifiers
FT   CDS             complement(174119..175378)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0162"
FT                   /product="nucleoside transporter"
FT                   /note="TIGRFAM: nucleoside transporter; PFAM: Na dependent
FT                   nucleoside transporter; nucleoside recognition domain
FT                   protein; Na dependent nucleoside transporter domain
FT                   protein; KEGG: hso:HS_0289 transport system permease"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31385"
FT                   /db_xref="GOA:B0UVM3"
FT                   /db_xref="InterPro:IPR002668"
FT                   /db_xref="InterPro:IPR008276"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="InterPro:IPR011657"
FT                   /db_xref="InterPro:IPR018270"
FT                   /db_xref="UniProtKB/TrEMBL:B0UVM3"
FT                   /protein_id="ACA31385.1"
FT                   /translation="MSSLISIIGIFALLLIAFLLSNNRKAINYRTVLGALLIQFLFGAF
FT                   ILYVPVGRQALQSVAGAVQSVINYGNEGIRFLFNGLAPQADGSMGSAGFVFVINVLPNI
FT                   VFFSALISLLYYIGVMQWLIKIIGGALQKALGTSKSESMSAAANIFVGQTEAPLVIKPY
FT                   ISKMTESELFAVMCGGLASIAGSVMAGYAGMGVPLTYLIAASFMAAPAGLLFAKILIPQ
FT                   TEKFNDNFEQIQQEKPTNILDAAAGGASSGMQLALNVGAMLIAFVALIALLNGILGTIG
FT                   NWIGQEGLSLGMIFGWVFKPLAFIIGVPWEEAEIAGRMIGTKLAINEFVGYLDFVPYLA
FT                   ADAAVQLSDKTKAIITFALCGFANFSSIAILIGGLGAMAPNRRGDIARLGIKAVIAGSL
FT                   ANLMSATIAGLFIGLSGAAL"
     MSSLISIIGI FALLLIAFLL SNNRKAINYR TVLGALLIQF LFGAFILYVP VGRQALQSVA        60
     GAVQSVINYG NEGIRFLFNG LAPQADGSMG SAGFVFVINV LPNIVFFSAL ISLLYYIGVM       120
     QWLIKIIGGA LQKALGTSKS ESMSAAANIF VGQTEAPLVI KPYISKMTES ELFAVMCGGL       180
     ASIAGSVMAG YAGMGVPLTY LIAASFMAAP AGLLFAKILI PQTEKFNDNF EQIQQEKPTN       240
     ILDAAAGGAS SGMQLALNVG AMLIAFVALI ALLNGILGTI GNWIGQEGLS LGMIFGWVFK       300
     PLAFIIGVPW EEAEIAGRMI GTKLAINEFV GYLDFVPYLA ADAAVQLSDK TKAIITFALC       360
     GFANFSSIAI LIGGLGAMAP NRRGDIARLG IKAVIAGSLA NLMSATIAGL FIGLSGAAL        419
//

If you have problems or comments...

PBIL Back to PBIL home page