(data stored in ACNUC7421 zone)

EMBL: CP000947.PE162

CP000947.PE162       Location/Qualifiers
FT   CDS             176275..177843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0164"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   hhe:HH0773 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31407"
FT                   /db_xref="GOA:B0UVM5"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR027791"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B0UVM5"
FT                   /protein_id="ACA31407.1"
FT                   /translation="MMRLPISVTMLVKNAEKYLAKSLSSLKDFPEIIVLDNGSTDRSIE
FT                   IAKQFTNVKIYHSPFIGFGPMKNLVATYASYDWILNIDSDEILQPQLIQEISQLNFDEP
FT                   RKVYALLRINHYRGKPIKTCGWYPDFVKRLYNKKLVKFDDKRVHEALEIADDIQVVRLK
FT                   HEFNHYSFDSSEMLINKMQHYTALFAEQQKYRKKSSVLSAIAHGIVAFFKSYILKRGIL
FT                   SGGDGFIISFANASGSYYKYIKLMEANQSLTTALIITTYNRPDALEAVLVSVLAQSLLP
FT                   NEVIIADDGSTEDTKELIQKYQAIFPIPLKHVWQPDTGFRLAESRNKALSLVESEYVIT
FT                   IDGDMVLHPQFISDHRKAAEKNVFVGGGRILLTKDKTTALLQSSEQYSSFKWYEKGLET
FT                   RFEKRLMALHIPFLSEFIQRTKRVHYYNGIRGCNMAFFLSDALEINGFNNDFVGWGRED
FT                   SEFVARFFNNGGKRKNIKFAAIAYHLWHPEEDRKALPVNDELLKRAIEDKLVFCSNGLN
FT                   QIKLD"
     MMRLPISVTM LVKNAEKYLA KSLSSLKDFP EIIVLDNGST DRSIEIAKQF TNVKIYHSPF        60
     IGFGPMKNLV ATYASYDWIL NIDSDEILQP QLIQEISQLN FDEPRKVYAL LRINHYRGKP       120
     IKTCGWYPDF VKRLYNKKLV KFDDKRVHEA LEIADDIQVV RLKHEFNHYS FDSSEMLINK       180
     MQHYTALFAE QQKYRKKSSV LSAIAHGIVA FFKSYILKRG ILSGGDGFII SFANASGSYY       240
     KYIKLMEANQ SLTTALIITT YNRPDALEAV LVSVLAQSLL PNEVIIADDG STEDTKELIQ       300
     KYQAIFPIPL KHVWQPDTGF RLAESRNKAL SLVESEYVIT IDGDMVLHPQ FISDHRKAAE       360
     KNVFVGGGRI LLTKDKTTAL LQSSEQYSSF KWYEKGLETR FEKRLMALHI PFLSEFIQRT       420
     KRVHYYNGIR GCNMAFFLSD ALEINGFNND FVGWGREDSE FVARFFNNGG KRKNIKFAAI       480
     AYHLWHPEED RKALPVNDEL LKRAIEDKLV FCSNGLNQIK LD                          522
//

If you have problems or comments...

PBIL Back to PBIL home page