(data stored in ACNUC7421 zone)

EMBL: CP000947.PE163

CP000947.PE163       Location/Qualifiers
FT   CDS             178024..178272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0165"
FT                   /product="ribosomal protein S16"
FT                   /note="PFAM: ribosomal protein S16; KEGG: hso:HS_0293 30S
FT                   ribosomal protein S16"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31418"
FT                   /db_xref="GOA:B0UVM6"
FT                   /db_xref="InterPro:IPR000307"
FT                   /db_xref="InterPro:IPR023803"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UVM6"
FT                   /protein_id="ACA31418.1"
FT                   /translation="MVTIRLSRGGSKKRPFYQIVVADSRSPRDGRFIERVGFFNPLASG
FT                   NVERVRINLDRVNHWIGHGASLSDRVASLVKEAQKAA"
     MVTIRLSRGG SKKRPFYQIV VADSRSPRDG RFIERVGFFN PLASGNVERV RINLDRVNHW        60
     IGHGASLSDR VASLVKEAQK AA                                                 82
//

If you have problems or comments...

PBIL Back to PBIL home page