(data stored in ACNUC7421 zone)

EMBL: CP000947.PE164

CP000947.PE164       Location/Qualifiers
FT   CDS             178299..178826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0166"
FT                   /product="16S rRNA processing protein RimM"
FT                   /note="TIGRFAM: 16S rRNA processing protein RimM; PFAM:
FT                   RimM protein; PRC-barrel domain protein; KEGG: hso:HS_0294
FT                   16S rRNA processing protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31429"
FT                   /db_xref="GOA:B0UVM7"
FT                   /db_xref="InterPro:IPR002676"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR011961"
FT                   /db_xref="InterPro:IPR027275"
FT                   /db_xref="InterPro:IPR036976"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UVM7"
FT                   /protein_id="ACA31429.1"
FT                   /translation="MEQQRIEVVGKLGSTYGIRGWLRLYSSTEQAESIFDYQPWFLKIK
FT                   GQWQPIELESWKFHNHELIVKLKGINEREVAQTLANVEIGVNLSIFPLLDEGDFYWHDL
FT                   IGCQVVNLQGYAMGVVSEMMETGANDVLVVRASTKDAFGKKERLIPFLYEQVVKRVDLS
FT                   SKTIEVDWDAGF"
     MEQQRIEVVG KLGSTYGIRG WLRLYSSTEQ AESIFDYQPW FLKIKGQWQP IELESWKFHN        60
     HELIVKLKGI NEREVAQTLA NVEIGVNLSI FPLLDEGDFY WHDLIGCQVV NLQGYAMGVV       120
     SEMMETGAND VLVVRASTKD AFGKKERLIP FLYEQVVKRV DLSSKTIEVD WDAGF            175
//

If you have problems or comments...

PBIL Back to PBIL home page