(data stored in ACNUC7421 zone)

EMBL: CP000947.PE166

CP000947.PE166       Location/Qualifiers
FT   CDS             179653..180003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0168"
FT                   /product="ribosomal protein L19"
FT                   /note="PFAM: ribosomal protein L19; KEGG: hso:HS_0296 50S
FT                   ribosomal protein L19"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31451"
FT                   /db_xref="GOA:B0UVM9"
FT                   /db_xref="InterPro:IPR001857"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR018257"
FT                   /db_xref="InterPro:IPR038657"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UVM9"
FT                   /protein_id="ACA31451.1"
FT                   /translation="MSNIIKQIEQEQLKQNVPSFRPGDTLEVKVWVVEGSKRRLQAFEG
FT                   VVIAIRHRGLHSAFTLRKISNGVGVERVFQTHSPIIDSITVKRKGAVRKAKLYYLRERS
FT                   GKSARIKERLGN"
     MSNIIKQIEQ EQLKQNVPSF RPGDTLEVKV WVVEGSKRRL QAFEGVVIAI RHRGLHSAFT        60
     LRKISNGVGV ERVFQTHSPI IDSITVKRKG AVRKAKLYYL RERSGKSARI KERLGN           116
//

If you have problems or comments...

PBIL Back to PBIL home page