(data stored in ACNUC7421 zone)

EMBL: CP000947.PE168

CP000947.PE168       Location/Qualifiers
FT   CDS             complement(180993..181994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0170"
FT                   /product="periplasmic binding protein/LacI transcriptional
FT                   regulator"
FT                   /note="PFAM: regulatory protein LacI; periplasmic binding
FT                   protein/LacI transcriptional regulator; KEGG: hso:HS_0298
FT                   gluconate utilization operon repressor"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31474"
FT                   /db_xref="GOA:B0UVN1"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR001761"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B0UVN1"
FT                   /protein_id="ACA31474.1"
FT                   /translation="MPDKRKRPTLQDIASHLGITKMTISRYLRDPRLVAPKTGVRIAEA
FT                   IEHFGYIPNRAPEILSNAKSKAIGVLVPSLTNHVFADVIKGIENITDQAGYQTMLAHYG
FT                   YCQEKEEKRIESLLSYNIDGLILSETEHSARTLKMLDVANIPVVEIMDTSEFGLQQVVG
FT                   FNNIAAAQSMVETMIKRGYKNIVYFSARMDKRTRLKMQGYEQAMKKHQLTPHSLLTEEP
FT                   SSFTLGAEQLKLALKKHPQIDGIFCTNDDLAIGALFECQRQGIDVPKEIGIAGFHGLNV
FT                   GLSLTTQIATVRTPRLNIGEVAAKELLNRIEGIVPENYMINLGYNIHLGESI"
     MPDKRKRPTL QDIASHLGIT KMTISRYLRD PRLVAPKTGV RIAEAIEHFG YIPNRAPEIL        60
     SNAKSKAIGV LVPSLTNHVF ADVIKGIENI TDQAGYQTML AHYGYCQEKE EKRIESLLSY       120
     NIDGLILSET EHSARTLKML DVANIPVVEI MDTSEFGLQQ VVGFNNIAAA QSMVETMIKR       180
     GYKNIVYFSA RMDKRTRLKM QGYEQAMKKH QLTPHSLLTE EPSSFTLGAE QLKLALKKHP       240
     QIDGIFCTND DLAIGALFEC QRQGIDVPKE IGIAGFHGLN VGLSLTTQIA TVRTPRLNIG       300
     EVAAKELLNR IEGIVPENYM INLGYNIHLG ESI                                    333
//

If you have problems or comments...

PBIL Back to PBIL home page