(data stored in ACNUC7421 zone)

EMBL: CP000947.PE169

CP000947.PE169       Location/Qualifiers
FT   CDS             complement(182003..183055)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0171"
FT                   /product="tRNA/rRNA methyltransferase (SpoU)"
FT                   /note="PFAM: tRNA/rRNA methyltransferase (SpoU); RNA 2-O
FT                   ribose methyltransferase substrate binding; KEGG:
FT                   hso:HS_0299 tRNA/rRNA methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31485"
FT                   /db_xref="GOA:B0UVN2"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR016479"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:B0UVN2"
FT                   /protein_id="ACA31485.1"
FT                   /translation="MKTKKPIFQQANNEKRFTERFVSNKRYEKSTSKSPHVDNNSKRAL
FT                   SNRHSRPQNTQNTASHTHIINTTMEKPNGTGQVQVVLKRSSLVAKTEKKTGPLSPRAPE
FT                   KIKKNRAEEMKVYGENACLSLFAQRPESIVRVWTTVEMAHKVGDLFSYLASNKKVYHVV
FT                   DNSELALVSGTEHHGGICMLVKKRRPFTLHGYLDIPQQKNCLLVLNGVRNPHNIGGIIR
FT                   TCVCYGISAVVIDDVELLHSAVAMRVAEGGMEYIHPLEIDRTETALVKLRQAGYQIVHL
FT                   SSNKHAKTIKQLQLDDKVAFVLSEADTESLADKADELINLSLVNPLKHGLNVSVATGIL
FT                   LAKWTEVKLC"
     MKTKKPIFQQ ANNEKRFTER FVSNKRYEKS TSKSPHVDNN SKRALSNRHS RPQNTQNTAS        60
     HTHIINTTME KPNGTGQVQV VLKRSSLVAK TEKKTGPLSP RAPEKIKKNR AEEMKVYGEN       120
     ACLSLFAQRP ESIVRVWTTV EMAHKVGDLF SYLASNKKVY HVVDNSELAL VSGTEHHGGI       180
     CMLVKKRRPF TLHGYLDIPQ QKNCLLVLNG VRNPHNIGGI IRTCVCYGIS AVVIDDVELL       240
     HSAVAMRVAE GGMEYIHPLE IDRTETALVK LRQAGYQIVH LSSNKHAKTI KQLQLDDKVA       300
     FVLSEADTES LADKADELIN LSLVNPLKHG LNVSVATGIL LAKWTEVKLC                  350
//

If you have problems or comments...

PBIL Back to PBIL home page