(data stored in ACNUC7421 zone)

EMBL: CP000947.PE17

CP000947.PE17        Location/Qualifiers
FT   CDS             12891..15305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0017"
FT                   /product="ribonuclease R"
FT                   /EC_number="3.1.13.1"
FT                   /note="KEGG: hso:HS_0151 exoribonuclease II (ribonuclease
FT                   R); TIGRFAM: VacB and RNase II family 3'-5'
FT                   exoribonuclease; ribonuclease R; PFAM: ribonuclease II; RNA
FT                   binding S1 domain protein; Ribonuclease B OB region domain;
FT                   Ribonuclease R winged-helix domain protein; SMART: Cold
FT                   shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31473"
FT                   /db_xref="GOA:B0UUX5"
FT                   /db_xref="InterPro:IPR001900"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004476"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR011805"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013223"
FT                   /db_xref="InterPro:IPR013668"
FT                   /db_xref="InterPro:IPR022966"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR040476"
FT                   /db_xref="UniProtKB/TrEMBL:B0UUX5"
FT                   /protein_id="ACA31473.1"
FT                   /translation="MRTPKKTNKKAKKITALTEDPYFFQEQQKYANPIPSREFILQIIR
FT                   DFNAPMSKEDLFKTLAIVDPEQKEGMRRRLRAMENEGQLVFTKRKCYALPEKLDLLKGS
FT                   VIGHREGYGFLQIEGSKSDWFIPNIQMQKVIHGDFVLAQPNGYDRKGRSEVRIVRVLES
FT                   RNKHIVGRFFMEEGIGYVVPDDSRINRDILIPNEFRNGARMGQVVVVELKPRTATFTQL
FT                   VGKIVEILGENMAKGMETEIAIRNHDIPHIFPSAVEKQVRKYTDSVPEEAKQGRRDLRT
FT                   LPLVTIDGEDARDFDDAVFCQRSGDGGWTLWVAIADVSYYVRLRTALDNEAYQRGNSVY
FT                   FPNRVVPMLPEILSNGLCSLNPQVDRLCMVCEIRISPQGKMTDYSFYEAVMNSYARLTY
FT                   TKVAQILAGDELLQQRYHVLVPHLQELHQMYQALLQARYQRGAIDFETIETKFVFNEMG
FT                   RIECIEPMVRNDAHKIIEECMILANIAAANFMERHQEPALFRIHAGPSQEKLSAFRAFL
FT                   RECGLTLKGGINPTTADYAQLLAQVRERPDHELIQTMLLRSLSQAVYHPDNIGHFGLAL
FT                   TEYAHFTSPIRRYPDLTLHRSIKYLLAKQQGSKRKTTDTGGYHYSLEEMDLLGDHCSLT
FT                   ERRADDATREVADWLKCEYMQDHVGDEFDGIISSVTGFGLFVRLDDLFIDGLVHISTLD
FT                   NDYYQFDSIKQRLIGENSGTTYRLGDKVKIRVEAVSLAQRQVDFVLLSSQRKPRRSGKT
FT                   ANKRAKQKSFQEKNRTSKIERHKSAVKITKKLSKKQQSPASKTRKQKKQKG"
     MRTPKKTNKK AKKITALTED PYFFQEQQKY ANPIPSREFI LQIIRDFNAP MSKEDLFKTL        60
     AIVDPEQKEG MRRRLRAMEN EGQLVFTKRK CYALPEKLDL LKGSVIGHRE GYGFLQIEGS       120
     KSDWFIPNIQ MQKVIHGDFV LAQPNGYDRK GRSEVRIVRV LESRNKHIVG RFFMEEGIGY       180
     VVPDDSRINR DILIPNEFRN GARMGQVVVV ELKPRTATFT QLVGKIVEIL GENMAKGMET       240
     EIAIRNHDIP HIFPSAVEKQ VRKYTDSVPE EAKQGRRDLR TLPLVTIDGE DARDFDDAVF       300
     CQRSGDGGWT LWVAIADVSY YVRLRTALDN EAYQRGNSVY FPNRVVPMLP EILSNGLCSL       360
     NPQVDRLCMV CEIRISPQGK MTDYSFYEAV MNSYARLTYT KVAQILAGDE LLQQRYHVLV       420
     PHLQELHQMY QALLQARYQR GAIDFETIET KFVFNEMGRI ECIEPMVRND AHKIIEECMI       480
     LANIAAANFM ERHQEPALFR IHAGPSQEKL SAFRAFLREC GLTLKGGINP TTADYAQLLA       540
     QVRERPDHEL IQTMLLRSLS QAVYHPDNIG HFGLALTEYA HFTSPIRRYP DLTLHRSIKY       600
     LLAKQQGSKR KTTDTGGYHY SLEEMDLLGD HCSLTERRAD DATREVADWL KCEYMQDHVG       660
     DEFDGIISSV TGFGLFVRLD DLFIDGLVHI STLDNDYYQF DSIKQRLIGE NSGTTYRLGD       720
     KVKIRVEAVS LAQRQVDFVL LSSQRKPRRS GKTANKRAKQ KSFQEKNRTS KIERHKSAVK       780
     ITKKLSKKQQ SPASKTRKQK KQKG                                              804
//

If you have problems or comments...

PBIL Back to PBIL home page