(data stored in ACNUC7421 zone)

EMBL: CP000947.PE171

CP000947.PE171       Location/Qualifiers
FT   CDS             complement(184618..185328)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0173"
FT                   /product="Exonuclease RNase T and DNA polymerase III"
FT                   /note="PFAM: Exonuclease RNase T and DNA polymerase III;
FT                   SMART: Exonuclease; KEGG: hso:HS_0301 DNA polymerase III,
FT                   epsilon subunit"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31507"
FT                   /db_xref="GOA:B0UVN4"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:B0UVN4"
FT                   /protein_id="ACA31507.1"
FT                   /translation="MIKNFLNKFHPLNKLEKQRKIFINQDNLPVQWKRLFEKPYPKSST
FT                   DLTALSYLVIDFETTGLNSMMDNILSVATVPIDNLTLDISKAWHQFVAEQQEIKEDTVI
FT                   INHILPQMLNGAETLDDTMNKLFELMQGRILIAHGSTIEKRFILHYLNVRYNLSQFPLF
FT                   WLDTLKIERSLCQDNENNYQLSHIRNKYNLPEYIGHNALIDAISAGELFLAQLEKVFGK
FT                   SSKEIGEIYRRSIG"
     MIKNFLNKFH PLNKLEKQRK IFINQDNLPV QWKRLFEKPY PKSSTDLTAL SYLVIDFETT        60
     GLNSMMDNIL SVATVPIDNL TLDISKAWHQ FVAEQQEIKE DTVIINHILP QMLNGAETLD       120
     DTMNKLFELM QGRILIAHGS TIEKRFILHY LNVRYNLSQF PLFWLDTLKI ERSLCQDNEN       180
     NYQLSHIRNK YNLPEYIGHN ALIDAISAGE LFLAQLEKVF GKSSKEIGEI YRRSIG           236
//

If you have problems or comments...

PBIL Back to PBIL home page