(data stored in ACNUC7421 zone)

EMBL: CP000947.PE172

CP000947.PE172       Location/Qualifiers
FT   CDS             complement(185325..187205)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0174"
FT                   /product="putative CBS domain and cyclic
FT                   nucleotide-regulated nucleotidyltransferase"
FT                   /note="PFAM: cyclic nucleotide-binding; CBS domain
FT                   containing protein; protein of unknown function DUF294
FT                   nucleotidyltransferase putative; KEGG: hso:HS_0302 possible
FT                   signal-transduction protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31518"
FT                   /db_xref="GOA:B0UVN5"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR005105"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR018821"
FT                   /db_xref="UniProtKB/TrEMBL:B0UVN5"
FT                   /protein_id="ACA31518.1"
FT                   /translation="MDSSLIPNIELFIAQVPPFTHLPHDLIRLTAQNIEIRYIPKGELI
FT                   TNDEIDSLNNNENLYIVRMGSVEQVNKSGQLRARLESGDCFGFSIFNHHEQDKYQAYAL
FT                   ENTLIYQIPFQRLNELLKKFPEYASYFSSDAGKRLNSLAKNNFLKNQNDIFMKKVIDIA
FT                   NPKIALVDTNTTLQQAAIRMCEQRRSSALVMQQNKLIGIIHDRDMTKKVVAQGLDVNTL
FT                   VTEIMNINPPVIRGDELVLQAISMMMQHNIRSLPVIVDDKVQGILTATDLVKQNSMQSV
FT                   FIINRIFQANTLPLLVEIAKQQRDLFRALLERGVAYNNIMHVMTLIADAFARKLLMMAE
FT                   HKLGTPPCRYAWVVAGSQARYEMHPLSDQDNAIILERKLTALEQEYFVQLTKFVNNGLH
FT                   ECGYPYCTGNYMAINARWCVSLQEWKENFRSWIIAPELEGLLNASVFMDMRGIYGDLNL
FT                   ADQLQQYFVDLVAHNKRFLAFLVANSIRVKPPLSIFRNFVLIKEGEHKNKLNLKKRAIS
FT                   LLVDLARIYALAAGLAQTMSTEQRFRHCYKQGILNKETLNNALEVYQFVCNMRFKYQSD
FT                   ALQQQQELTNHIDPSELSALERNHLKDAFRLIAQFQEAAEIRFSQRGIMR"
     MDSSLIPNIE LFIAQVPPFT HLPHDLIRLT AQNIEIRYIP KGELITNDEI DSLNNNENLY        60
     IVRMGSVEQV NKSGQLRARL ESGDCFGFSI FNHHEQDKYQ AYALENTLIY QIPFQRLNEL       120
     LKKFPEYASY FSSDAGKRLN SLAKNNFLKN QNDIFMKKVI DIANPKIALV DTNTTLQQAA       180
     IRMCEQRRSS ALVMQQNKLI GIIHDRDMTK KVVAQGLDVN TLVTEIMNIN PPVIRGDELV       240
     LQAISMMMQH NIRSLPVIVD DKVQGILTAT DLVKQNSMQS VFIINRIFQA NTLPLLVEIA       300
     KQQRDLFRAL LERGVAYNNI MHVMTLIADA FARKLLMMAE HKLGTPPCRY AWVVAGSQAR       360
     YEMHPLSDQD NAIILERKLT ALEQEYFVQL TKFVNNGLHE CGYPYCTGNY MAINARWCVS       420
     LQEWKENFRS WIIAPELEGL LNASVFMDMR GIYGDLNLAD QLQQYFVDLV AHNKRFLAFL       480
     VANSIRVKPP LSIFRNFVLI KEGEHKNKLN LKKRAISLLV DLARIYALAA GLAQTMSTEQ       540
     RFRHCYKQGI LNKETLNNAL EVYQFVCNMR FKYQSDALQQ QQELTNHIDP SELSALERNH       600
     LKDAFRLIAQ FQEAAEIRFS QRGIMR                                            626
//

If you have problems or comments...

PBIL Back to PBIL home page