(data stored in ACNUC7421 zone)

EMBL: CP000947.PE173

CP000947.PE173       Location/Qualifiers
FT   CDS             complement(187307..189217)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0175"
FT                   /product="PfkB domain protein"
FT                   /note="PFAM: PfkB domain protein; KEGG: hso:HS_0303
FT                   myo-inositol catabolism protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31529"
FT                   /db_xref="GOA:B0UVN6"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018659"
FT                   /db_xref="InterPro:IPR023314"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="InterPro:IPR030830"
FT                   /db_xref="UniProtKB/TrEMBL:B0UVN6"
FT                   /protein_id="ACA31529.1"
FT                   /translation="MKKEKTLDLICLGRVAVDLYAQQIGSRLEDVSSFAKYLGGSSGNV
FT                   AYGTAVQGVKSSMLARVGDEHMGRFLREELQRLGVDTSHLITDKERLTALVILGIKDQD
FT                   TFPLIFYRDNCADMAITADDFDEEYIASAKALAITGTHLSHPKTRHAVLTALEYAGRNG
FT                   TKRLLDIDYRPVLWGLTSLGDGETRFIDSEAVTQSLQEVLHHFDVLVGTEEEFHIAGGS
FT                   TDTLTALKNVRKVSNATLVCKRGALGCSVFEGDIPNHIDGGINVYGVRVEVLNVLGAGD
FT                   AFMSGLLRGYINGESWEQCCRYANACGALVVSRHGCAPAMPTKEELDNYLSRAESVPRP
FT                   DLDEQLNHLHRVTTRKQQWHDLCIFAFDHRKQLVDMAEKCGADLKRIPTLKTLLLKAAE
FT                   QTAQKEGIYNGNAGVLADTTFGQEALNEITGKKWWIGRPIEMPSSRPLRLEHGDLGSQL
FT                   ISWPAEHVVKCLAFYHPADKAELKADQDATLKEVYRACCRTGHELLLEIILPADMEQKE
FT                   SYYTDMIAHFYSLGIKPDWWKLPGVSAKTWADISQVIEKNDKHCRGILILGLDAPEAVF
FT                   ENVFKASANAPLVKGFAVGRTIFGQPSADWLAGKIDDEQLIKETSERYRRLIKLWKNRK
FT                   N"
     MKKEKTLDLI CLGRVAVDLY AQQIGSRLED VSSFAKYLGG SSGNVAYGTA VQGVKSSMLA        60
     RVGDEHMGRF LREELQRLGV DTSHLITDKE RLTALVILGI KDQDTFPLIF YRDNCADMAI       120
     TADDFDEEYI ASAKALAITG THLSHPKTRH AVLTALEYAG RNGTKRLLDI DYRPVLWGLT       180
     SLGDGETRFI DSEAVTQSLQ EVLHHFDVLV GTEEEFHIAG GSTDTLTALK NVRKVSNATL       240
     VCKRGALGCS VFEGDIPNHI DGGINVYGVR VEVLNVLGAG DAFMSGLLRG YINGESWEQC       300
     CRYANACGAL VVSRHGCAPA MPTKEELDNY LSRAESVPRP DLDEQLNHLH RVTTRKQQWH       360
     DLCIFAFDHR KQLVDMAEKC GADLKRIPTL KTLLLKAAEQ TAQKEGIYNG NAGVLADTTF       420
     GQEALNEITG KKWWIGRPIE MPSSRPLRLE HGDLGSQLIS WPAEHVVKCL AFYHPADKAE       480
     LKADQDATLK EVYRACCRTG HELLLEIILP ADMEQKESYY TDMIAHFYSL GIKPDWWKLP       540
     GVSAKTWADI SQVIEKNDKH CRGILILGLD APEAVFENVF KASANAPLVK GFAVGRTIFG       600
     QPSADWLAGK IDDEQLIKET SERYRRLIKL WKNRKN                                 636
//

If you have problems or comments...

PBIL Back to PBIL home page