(data stored in ACNUC7421 zone)

EMBL: CP000947.PE174

CP000947.PE174       Location/Qualifiers
FT   CDS             189460..190302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0176"
FT                   /product="transcriptional regulator, RpiR family"
FT                   /note="PFAM: helix-turn-helix protein RpiR; sugar isomerase
FT                   (SIS); KEGG: hso:HS_0304 possible transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31540"
FT                   /db_xref="GOA:B0UVN7"
FT                   /db_xref="InterPro:IPR000281"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR035472"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B0UVN7"
FT                   /protein_id="ACA31540.1"
FT                   /translation="MQEHSQLVTLQNEIRSRYSTLSKRLKQVAQYVLDNHNSVIFDTVA
FT                   TISERAGVPPSTLIRFANAFGFSGFNEMKQIFRENLIEETANYTERLQVFRQLEPEKSE
FT                   QHNLQDILNIFAQANNQALKQLSSQTTTKQLKSAVEILKNAQNIFIIGLKRSFSIACYL
FT                   DYVLHHLDCRSFLINGLGGMFDEQLMQVKKGDVIVAVSFSPYAKETLEIVSATSQKGVK
FT                   HIAITDSQISPLIASSDVAFVVKEAQVSGFRSQCATMTLVQTLAILLGLEKEKETQNS"
     MQEHSQLVTL QNEIRSRYST LSKRLKQVAQ YVLDNHNSVI FDTVATISER AGVPPSTLIR        60
     FANAFGFSGF NEMKQIFREN LIEETANYTE RLQVFRQLEP EKSEQHNLQD ILNIFAQANN       120
     QALKQLSSQT TTKQLKSAVE ILKNAQNIFI IGLKRSFSIA CYLDYVLHHL DCRSFLINGL       180
     GGMFDEQLMQ VKKGDVIVAV SFSPYAKETL EIVSATSQKG VKHIAITDSQ ISPLIASSDV       240
     AFVVKEAQVS GFRSQCATMT LVQTLAILLG LEKEKETQNS                             280
//

If you have problems or comments...

PBIL Back to PBIL home page