(data stored in ACNUC7421 zone)

EMBL: CP000947.PE175

CP000947.PE175       Location/Qualifiers
FT   CDS             complement(190339..191103)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0177"
FT                   /product="protein of unknown function DUF548"
FT                   /note="PFAM: protein of unknown function DUF548; KEGG:
FT                   hso:HS_0305 possible SAM-dependent methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31551"
FT                   /db_xref="GOA:B0UVN8"
FT                   /db_xref="InterPro:IPR007536"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UVN8"
FT                   /protein_id="ACA31551.1"
FT                   /translation="MVNQKIQLICETESAVQFTALCQQKGLIHDPNSYLALVQTKVEGQ
FT                   VRLELRKLDEPKLGAVYVDFVTGTMAHRRKFGGGRAEAVAKAVGIKGNYLPTVIDATAG
FT                   LGRDAFVLAALGCKVRLVERHPVVHLLLQDGLKRAYADAEIGTMMQANMQLLDIAHIQE
FT                   LNSSEEGADVVYLDPMYPHKQKSALVKKEMRIFQHLIGADLDADMLLEPALLLAQKRAV
FT                   VKRPDYADFLAKKTPHFSHQTKNHRFDIYLKT"
     MVNQKIQLIC ETESAVQFTA LCQQKGLIHD PNSYLALVQT KVEGQVRLEL RKLDEPKLGA        60
     VYVDFVTGTM AHRRKFGGGR AEAVAKAVGI KGNYLPTVID ATAGLGRDAF VLAALGCKVR       120
     LVERHPVVHL LLQDGLKRAY ADAEIGTMMQ ANMQLLDIAH IQELNSSEEG ADVVYLDPMY       180
     PHKQKSALVK KEMRIFQHLI GADLDADMLL EPALLLAQKR AVVKRPDYAD FLAKKTPHFS       240
     HQTKNHRFDI YLKT                                                         254
//

If you have problems or comments...

PBIL Back to PBIL home page