(data stored in ACNUC7421 zone)

EMBL: CP000947.PE177

CP000947.PE177       Location/Qualifiers
FT   CDS             complement(192245..192574)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0179"
FT                   /product="protein of unknown function DUF413"
FT                   /note="PFAM: protein of unknown function DUF413; KEGG:
FT                   hso:HS_0307 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31573"
FT                   /db_xref="InterPro:IPR007335"
FT                   /db_xref="UniProtKB/TrEMBL:B0UVP0"
FT                   /protein_id="ACA31573.1"
FT                   /translation="MAESFSVTRRFFDDKNYPRGFARHGDYTIRESQTLEQYGQAFKAL
FT                   DLGERVPVTEEEKAFVAFCRGERPAETYFEKTWNKYRTRISASKRVYTLSGVVGADNPD
FT                   DFSAE"
     MAESFSVTRR FFDDKNYPRG FARHGDYTIR ESQTLEQYGQ AFKALDLGER VPVTEEEKAF        60
     VAFCRGERPA ETYFEKTWNK YRTRISASKR VYTLSGVVGA DNPDDFSAE                   109
//

If you have problems or comments...

PBIL Back to PBIL home page