(data stored in ACNUC7421 zone)

EMBL: CP000947.PE178

CP000947.PE178       Location/Qualifiers
FT   CDS             complement(192628..193236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0180"
FT                   /product="DSBA oxidoreductase"
FT                   /note="PFAM: DSBA oxidoreductase; KEGG: hso:HS_0308 protein
FT                   disulfide-isomerase (thiol:disulfide interchange protein)"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31585"
FT                   /db_xref="GOA:B0UVP1"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR023205"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B0UVP1"
FT                   /protein_id="ACA31585.1"
FT                   /translation="MKKFLWALASFFFLNSTQALALQEGKQYIELEQPRSVQPEVIEFF
FT                   SFGCIHCFNFEKTYQIPQQIKADLPKDVTFKQYHVDWMGEDIVRAWSLAILLGIEEKVK
FT                   MPLFELIIEKRKAPTLDNIREVFLANGITAAQFDGGINSFAVTAQTNKQIALAKKLGVR
FT                   ATPEFYINGKYKVNAEGLSRTTDGFIKDYVETVKGLLQK"
     MKKFLWALAS FFFLNSTQAL ALQEGKQYIE LEQPRSVQPE VIEFFSFGCI HCFNFEKTYQ        60
     IPQQIKADLP KDVTFKQYHV DWMGEDIVRA WSLAILLGIE EKVKMPLFEL IIEKRKAPTL       120
     DNIREVFLAN GITAAQFDGG INSFAVTAQT NKQIALAKKL GVRATPEFYI NGKYKVNAEG       180
     LSRTTDGFIK DYVETVKGLL QK                                                202
//

If you have problems or comments...

PBIL Back to PBIL home page