(data stored in ACNUC7421 zone)

EMBL: CP000947.PE179

CP000947.PE179       Location/Qualifiers
FT   CDS             complement(193246..193512)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0181"
FT                   /product="protein of unknown function DUF1040"
FT                   /note="PFAM: protein of unknown function DUF1040; KEGG:
FT                   hso:HS_0309 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31596"
FT                   /db_xref="InterPro:IPR009383"
FT                   /db_xref="InterPro:IPR038134"
FT                   /db_xref="UniProtKB/TrEMBL:B0UVP2"
FT                   /protein_id="ACA31596.1"
FT                   /translation="MKCHRLNEVLELLQPYWSNNPDLHLIQVLQKIAEETGFDKPIAEL
FT                   TDEVIIYHLKMYGTGKNEPIPGIKKDYEDDFKTALLKARGIID"
     MKCHRLNEVL ELLQPYWSNN PDLHLIQVLQ KIAEETGFDK PIAELTDEVI IYHLKMYGTG        60
     KNEPIPGIKK DYEDDFKTAL LKARGIID                                           88
//

If you have problems or comments...

PBIL Back to PBIL home page