(data stored in ACNUC7421 zone)

EMBL: CP000947.PE18

CP000947.PE18        Location/Qualifiers
FT   CDS             15312..16049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0018"
FT                   /product="RNA methyltransferase, TrmH family, group 3"
FT                   /note="TIGRFAM: RNA methyltransferase, TrmH family, group
FT                   3; PFAM: tRNA/rRNA methyltransferase (SpoU); RNA 2-O ribose
FT                   methyltransferase substrate binding; KEGG: hso:HS_0152
FT                   tRNA/rRNA methyltransferase, SpoU family"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31584"
FT                   /db_xref="GOA:B0UUX6"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR004441"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR024915"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:B0UUX6"
FT                   /protein_id="ACA31584.1"
FT                   /translation="MAENIYGIHAVQAFLINAPERLIEVYVLKGREDKRLQSVLNELYK
FT                   LGISVQFLNRDTLDKKANGEVHQGIIARVQPAKELNENDLVEILQKKANPLLLVLDGIT
FT                   DPHNLGACLRSADAAGVCAVIVPKDKSAQLTAIARKVACGAAEVVPLVRVTNLARTLRD
FT                   LQQQHNIWVVGTAGEAIETLYEAKLTGGLALVMGAEGDGMRRLTRETCDQLISIPMAGS
FT                   VSSLNVSVATGICLFEIVRQRLG"
     MAENIYGIHA VQAFLINAPE RLIEVYVLKG REDKRLQSVL NELYKLGISV QFLNRDTLDK        60
     KANGEVHQGI IARVQPAKEL NENDLVEILQ KKANPLLLVL DGITDPHNLG ACLRSADAAG       120
     VCAVIVPKDK SAQLTAIARK VACGAAEVVP LVRVTNLART LRDLQQQHNI WVVGTAGEAI       180
     ETLYEAKLTG GLALVMGAEG DGMRRLTRET CDQLISIPMA GSVSSLNVSV ATGICLFEIV       240
     RQRLG                                                                   245
//

If you have problems or comments...

PBIL Back to PBIL home page