(data stored in ACNUC7421 zone)

EMBL: CP000947.PE180

CP000947.PE180       Location/Qualifiers
FT   CDS             193579..194166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0182"
FT                   /product="molybdopterin-guanine dinucleotide biosynthesis
FT                   protein A"
FT                   /note="TIGRFAM: molybdopterin-guanine dinucleotide
FT                   biosynthesis protein A; KEGG: hso:HS_0310
FT                   molybdopterin-guanine dinucleotide biosynthesis protein A"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31607"
FT                   /db_xref="GOA:B0UVP3"
FT                   /db_xref="InterPro:IPR013482"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UVP3"
FT                   /protein_id="ACA31607.1"
FT                   /translation="MATTISAVILAGGQAKRMAGLDKGLQLLQGKPLYQHCLQRLTNQV
FT                   SSISINANRHQAIYQQSGVEVFGDELEDFQGPLSGILTALERANTDFVLFVPCDSPFLP
FT                   LNLCEKLQSAVENSKSLLAYANDGEREHPAFSLLSTQLKLPLRVYLQSGHRQMLQFFRQ
FT                   HKAISVDFSLQKQAFVNMNTLQDIEKYQNIYA"
     MATTISAVIL AGGQAKRMAG LDKGLQLLQG KPLYQHCLQR LTNQVSSISI NANRHQAIYQ        60
     QSGVEVFGDE LEDFQGPLSG ILTALERANT DFVLFVPCDS PFLPLNLCEK LQSAVENSKS       120
     LLAYANDGER EHPAFSLLST QLKLPLRVYL QSGHRQMLQF FRQHKAISVD FSLQKQAFVN       180
     MNTLQDIEKY QNIYA                                                        195
//

If you have problems or comments...

PBIL Back to PBIL home page