(data stored in ACNUC7421 zone)

EMBL: CP000947.PE181

CP000947.PE181       Location/Qualifiers
FT   CDS             194285..196291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0183"
FT                   /product="oligopeptide transporter, OPT family"
FT                   /note="TIGRFAM: oligopeptide transporters, OPT superfamily;
FT                   oligopeptide transporter, OPT family; PFAM: Oligopeptide
FT                   transporter OPT superfamily protein; KEGG: hso:HS_0311
FT                   integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31616"
FT                   /db_xref="GOA:B0UVP4"
FT                   /db_xref="InterPro:IPR004813"
FT                   /db_xref="InterPro:IPR004814"
FT                   /db_xref="UniProtKB/TrEMBL:B0UVP4"
FT                   /protein_id="ACA31616.1"
FT                   /translation="MLSKQQSLKELTFRGMLLGALITVVFTASNVYLGLKVGLTFASSV
FT                   PAAVISMAVLKFFKGSNILENNMVQTQASSAGTLSSVIFVIPAMLMLGYWQGFPFWQTL
FT                   LICISGGMLGVIFTVPLRNVMVVKSDLPYPEGVAAAEVLKAGNDEIGGRGVKELTIGGL
FT                   IAAVAGFLTNGLRVIADSASLWFKGGNAIFQVPMGFSLALLGAGYLVGMIGGLAILLGI
FT                   FVAWGVAVPYFTSVAPMPSDADMIGYAFSIWKNKVRFIGVGTIGIAAIWTLLVLMKPMI
FT                   QGMIESFRALKDPNAKNTDRTSQDLSPTTLIFTTLVSVVLIVLALYSFINPVGIEAGTA
FT                   IILILVCTLLAVVIGFLVAAACGYMAGLVGSSSSPISGIGIISVVTTSLVLMLVGSATG
FT                   LLDTAEGQKFLTALTLFTGSIVVCIAAISNDNLQDLKTGQLVEATPWRQQFALIIGVIV
FT                   GALVIAPVLEILYHAYGFAGAMPRETMDPSQALFAPQATLMMTIANGIFSHNLEWNYIF
FT                   FGIGFGAVLIFIDSVLKKASNKRLALPALAVGMGIYLPPSVNAPIVVGALLAWLINRHL
FT                   ENFAKRTGKDLADVKKKAERFGTLFAAGLIVGESLIGILLAFIVAGSVTSGGSDAPLAL
FT                   HLENWESLAQVLGLMMFATGITIFALRVLKAKQ"
     MLSKQQSLKE LTFRGMLLGA LITVVFTASN VYLGLKVGLT FASSVPAAVI SMAVLKFFKG        60
     SNILENNMVQ TQASSAGTLS SVIFVIPAML MLGYWQGFPF WQTLLICISG GMLGVIFTVP       120
     LRNVMVVKSD LPYPEGVAAA EVLKAGNDEI GGRGVKELTI GGLIAAVAGF LTNGLRVIAD       180
     SASLWFKGGN AIFQVPMGFS LALLGAGYLV GMIGGLAILL GIFVAWGVAV PYFTSVAPMP       240
     SDADMIGYAF SIWKNKVRFI GVGTIGIAAI WTLLVLMKPM IQGMIESFRA LKDPNAKNTD       300
     RTSQDLSPTT LIFTTLVSVV LIVLALYSFI NPVGIEAGTA IILILVCTLL AVVIGFLVAA       360
     ACGYMAGLVG SSSSPISGIG IISVVTTSLV LMLVGSATGL LDTAEGQKFL TALTLFTGSI       420
     VVCIAAISND NLQDLKTGQL VEATPWRQQF ALIIGVIVGA LVIAPVLEIL YHAYGFAGAM       480
     PRETMDPSQA LFAPQATLMM TIANGIFSHN LEWNYIFFGI GFGAVLIFID SVLKKASNKR       540
     LALPALAVGM GIYLPPSVNA PIVVGALLAW LINRHLENFA KRTGKDLADV KKKAERFGTL       600
     FAAGLIVGES LIGILLAFIV AGSVTSGGSD APLALHLENW ESLAQVLGLM MFATGITIFA       660
     LRVLKAKQ                                                                668
//

If you have problems or comments...

PBIL Back to PBIL home page