(data stored in ACNUC7421 zone)

EMBL: CP000947.PE182

CP000947.PE182       Location/Qualifiers
FT   CDS             complement(196413..197171)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0184"
FT                   /product="Sel1 domain protein repeat-containing protein"
FT                   /note="PFAM: Sel1 domain protein repeat-containing protein;
FT                   KEGG: hso:HS_0313 conserved hypothetical protein, with TPR
FT                   repeat (tetratrico peptide repeat)"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31627"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:B0UVP5"
FT                   /protein_id="ACA31627.1"
FT                   /translation="MNLKKSLLIALLSFGVAQSALAETNSEKLDRATQLYKQQNYSAAF
FT                   PLLKQLGEKGNAKAQAVLGTMYMFGQGITQNSQQAVYWYTKAAEQGDAKAQSMLGFMYT
FT                   NGLGVTQNSQQAVYWWTKAAEQGAAEVQLYLGVMYANGQGVAQNYQQAVYWFTKAAEQG
FT                   IAEAQLYLGVMYANGQGVAQNYQQAVYWFTKAAEQGIAEAQLYLGDMYEKGRGAQKNVS
FT                   TAKAFYGQACDNGNAQGCKDFARLDKQGVR"
     MNLKKSLLIA LLSFGVAQSA LAETNSEKLD RATQLYKQQN YSAAFPLLKQ LGEKGNAKAQ        60
     AVLGTMYMFG QGITQNSQQA VYWYTKAAEQ GDAKAQSMLG FMYTNGLGVT QNSQQAVYWW       120
     TKAAEQGAAE VQLYLGVMYA NGQGVAQNYQ QAVYWFTKAA EQGIAEAQLY LGVMYANGQG       180
     VAQNYQQAVY WFTKAAEQGI AEAQLYLGDM YEKGRGAQKN VSTAKAFYGQ ACDNGNAQGC       240
     KDFARLDKQG VR                                                           252
//

If you have problems or comments...

PBIL Back to PBIL home page